Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   ETT73_RS00745 Genome accession   NZ_CP035426
Coordinates   110568..110852 (+) Length   94 a.a.
NCBI ID   WP_011284422.1    Uniprot ID   -
Organism   Streptococcus pyogenes strain emm57     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 105568..115852
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ETT73_RS00720 (ETT73_00720) - 107514..107879 (+) 366 WP_002986560.1 DUF1033 family protein -
  ETT73_RS00725 (ETT73_00725) comGA 107972..108910 (+) 939 WP_002987773.1 competence type IV pilus ATPase ComGA Machinery gene
  ETT73_RS00730 (ETT73_00730) comGB 108846..109880 (+) 1035 WP_011054115.1 competence type IV pilus assembly protein ComGB Machinery gene
  ETT73_RS00735 (ETT73_00735) comGC 109882..110208 (+) 327 WP_002986552.1 competence type IV pilus major pilin ComGC Machinery gene
  ETT73_RS00740 (ETT73_00740) comGD 110183..110611 (+) 429 WP_002986548.1 competence type IV pilus minor pilin ComGD Machinery gene
  ETT73_RS00745 (ETT73_00745) comGE 110568..110852 (+) 285 WP_011284422.1 competence type IV pilus minor pilin ComGE Machinery gene
  ETT73_RS00750 (ETT73_00750) comGF 110845..111279 (+) 435 WP_002992738.1 competence type IV pilus minor pilin ComGF Machinery gene
  ETT73_RS00755 (ETT73_00755) comGG 111263..111589 (+) 327 WP_010921801.1 competence type IV pilus minor pilin ComGG -
  ETT73_RS00760 (ETT73_00760) comGH 111687..112640 (+) 954 WP_010921802.1 class I SAM-dependent methyltransferase Machinery gene
  ETT73_RS00765 (ETT73_00765) - 112699..113895 (+) 1197 WP_010921803.1 acetate kinase -
  ETT73_RS00770 (ETT73_00770) - 114081..114389 (+) 309 WP_136112674.1 hypothetical protein -
  ETT73_RS00775 (ETT73_00775) proC 114472..115242 (-) 771 WP_002986527.1 pyrroline-5-carboxylate reductase -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10654.59 Da        Isoelectric Point: 8.9043

>NTDB_id=300770 ETT73_RS00745 WP_011284422.1 110568..110852(+) (comGE) [Streptococcus pyogenes strain emm57]
MGIIKKQVKAYIALESMIATGILFSIVILVLSSLQQSQAALTYYRKQQEKLNLALMAVQTRTKEITLNGCHITILRTDRY
ISIHDDEGEVMKIE

Nucleotide


Download         Length: 285 bp        

>NTDB_id=300770 ETT73_RS00745 WP_011284422.1 110568..110852(+) (comGE) [Streptococcus pyogenes strain emm57]
GTGGGAATTATCAAAAAACAAGTCAAAGCTTACATAGCCCTTGAAAGTATGATTGCAACAGGCATCCTCTTTAGTATTGT
CATTCTCGTCTTAAGCAGTTTACAGCAGAGTCAGGCTGCTCTAACGTACTATCGAAAGCAGCAAGAAAAGCTTAATCTAG
CCTTGATGGCAGTACAAACTAGAACTAAAGAGATAACATTGAATGGTTGTCATATTACTATTTTACGTACGGATAGATAC
ATTAGTATTCACGATGACGAAGGAGAAGTGATGAAGATTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Lactococcus lactis subsp. cremoris KW2

38.298

100

0.383