Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   ES963_RS16815 Genome accession   NZ_CP035390
Coordinates   3103460..3103600 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain SRCM103641     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3098460..3108600
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ES963_RS16790 (ES963_16790) yuxO 3098810..3099190 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  ES963_RS16795 (ES963_16795) comA 3099209..3099853 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  ES963_RS16800 (ES963_16800) comP 3099934..3102231 (-) 2298 WP_087614687.1 histidine kinase Regulator
  ES963_RS16805 (ES963_16805) comX 3102239..3102400 (-) 162 WP_003241045.1 competence pheromone ComX -
  ES963_RS16810 (ES963_16810) comQ 3102415..3103275 (-) 861 WP_046160795.1 polyprenyl synthetase family protein Regulator
  ES963_RS16815 (ES963_16815) degQ 3103460..3103600 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  ES963_RS16820 (ES963_16820) - 3103822..3103947 (+) 126 WP_003228793.1 hypothetical protein -
  ES963_RS16825 (ES963_16825) - 3104062..3104430 (+) 369 WP_046381300.1 hypothetical protein -
  ES963_RS16830 (ES963_16830) pdeH 3104406..3105635 (-) 1230 WP_046381301.1 cyclic di-GMP phosphodiesterase -
  ES963_RS16835 (ES963_16835) pncB 3105772..3107244 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  ES963_RS16840 (ES963_16840) pncA 3107260..3107811 (-) 552 WP_038828671.1 isochorismatase family cysteine hydrolase -
  ES963_RS16845 (ES963_16845) yueI 3107908..3108306 (-) 399 WP_015251331.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=298630 ES963_RS16815 WP_003220708.1 3103460..3103600(-) (degQ) [Bacillus subtilis strain SRCM103641]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=298630 ES963_RS16815 WP_003220708.1 3103460..3103600(-) (degQ) [Bacillus subtilis strain SRCM103641]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment