Detailed information
Bioinformatically predicted
Overview
| Name | cipB | Type | Regulator |
| Locus tag | EQH18_RS02435 | Genome accession | NZ_CP035262 |
| Coordinates | 484176..484325 (+) | Length | 49 a.a. |
| NCBI ID | WP_001813641.1 | Uniprot ID | - |
| Organism | Streptococcus pneumoniae strain TVO_1901923 | ||
| Function | indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation |
||
Genomic Context
Location: 479176..489325
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EQH18_RS02400 (EQH18_02555) | blpU | 481040..481270 (+) | 231 | WP_001093268.1 | bacteriocin-like peptide BlpU | - |
| EQH18_RS02405 (EQH18_02560) | - | 481273..481392 (+) | 120 | WP_000346298.1 | PncF family bacteriocin immunity protein | - |
| EQH18_RS02410 (EQH18_02565) | - | 481689..481853 (+) | 165 | WP_000727118.1 | hypothetical protein | - |
| EQH18_RS02415 (EQH18_02570) | - | 481850..482254 (+) | 405 | WP_000846944.1 | hypothetical protein | - |
| EQH18_RS02420 (EQH18_02575) | - | 482452..483257 (+) | 806 | Protein_485 | IS5 family transposase | - |
| EQH18_RS02425 (EQH18_02580) | blpM | 483459..483713 (+) | 255 | WP_000379879.1 | two-peptide bacteriocin subunit BlpM | - |
| EQH18_RS02430 (EQH18_02585) | blpN | 483729..483932 (+) | 204 | WP_001099492.1 | two-peptide bacteriocin subunit BlpN | - |
| EQH18_RS02435 (EQH18_02595) | cipB | 484176..484325 (+) | 150 | WP_001813641.1 | bacteriocin-like peptide BlpO | Regulator |
| EQH18_RS02440 (EQH18_02600) | - | 484429..484548 (+) | 120 | WP_000346296.1 | PncF family bacteriocin immunity protein | - |
| EQH18_RS02445 (EQH18_02610) | - | 485334..485717 (+) | 384 | WP_000877378.1 | hypothetical protein | - |
| EQH18_RS02450 (EQH18_02615) | - | 485769..486458 (+) | 690 | WP_000760541.1 | CPBP family intramembrane glutamic endopeptidase | - |
| EQH18_RS02455 (EQH18_02620) | blpZ | 486500..486733 (+) | 234 | WP_000276498.1 | immunity protein BlpZ | - |
| EQH18_RS02460 (EQH18_02630) | - | 486884..487495 (+) | 612 | WP_000394045.1 | CPBP family intramembrane glutamic endopeptidase | - |
| EQH18_RS02465 (EQH18_02635) | ccrZ | 487656..488450 (+) | 795 | WP_000363002.1 | cell cycle regulator CcrZ | - |
| EQH18_RS02470 (EQH18_02640) | trmB | 488447..489082 (+) | 636 | WP_001266078.1 | tRNA (guanosine(46)-N7)-methyltransferase TrmB | - |
Sequence
Protein
Download Length: 49 a.a. Molecular weight: 5164.93 Da Isoelectric Point: 3.9133
>NTDB_id=297652 EQH18_RS02435 WP_001813641.1 484176..484325(+) (cipB) [Streptococcus pneumoniae strain TVO_1901923]
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCTAGVAYGAIDGCATTV
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCTAGVAYGAIDGCATTV
Nucleotide
Download Length: 150 bp
>NTDB_id=297652 EQH18_RS02435 WP_001813641.1 484176..484325(+) (cipB) [Streptococcus pneumoniae strain TVO_1901923]
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTACAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTACAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| cipB | Streptococcus mutans UA159 |
48.98 |
100 |
0.49 |