Detailed information
Bioinformatically predicted
Overview
| Name | cipB | Type | Regulator |
| Locus tag | EQH31_RS02580 | Genome accession | NZ_CP035249 |
| Coordinates | 504327..504476 (+) | Length | 49 a.a. |
| NCBI ID | WP_001818346.1 | Uniprot ID | Q9FBH1 |
| Organism | Streptococcus pneumoniae strain TVO_1901938 | ||
| Function | indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation |
||
Genomic Context
Location: 499327..509476
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EQH31_RS02530 (EQH31_02705) | blpI | 499362..499559 (+) | 198 | WP_001093259.1 | bacteriocin-like peptide BlpI | - |
| EQH31_RS02535 (EQH31_02715) | blpJ | 500026..500295 (+) | 270 | WP_001093248.1 | bacteriocin-like peptide BlpJ | - |
| EQH31_RS02540 (EQH31_02720) | blpU | 500364..500594 (+) | 231 | WP_000379964.1 | bacteriocin-like peptide BlpU | - |
| EQH31_RS02545 (EQH31_02725) | - | 500597..500716 (+) | 120 | WP_001844187.1 | PncF family bacteriocin immunity protein | - |
| EQH31_RS02550 (EQH31_02730) | - | 501015..501179 (+) | 165 | WP_000727118.1 | hypothetical protein | - |
| EQH31_RS02555 (EQH31_02735) | - | 501176..501571 (+) | 396 | WP_000846569.1 | hypothetical protein | - |
| EQH31_RS02560 (EQH31_02740) | - | 501585..502399 (-) | 815 | Protein_512 | IS5-like element IS1515 family transposase | - |
| EQH31_RS02565 (EQH31_02750) | - | 502656..503460 (+) | 805 | WP_128887636.1 | IS5 family transposase | - |
| EQH31_RS02570 (EQH31_02755) | blpM | 503610..503864 (+) | 255 | WP_000379879.1 | two-peptide bacteriocin subunit BlpM | - |
| EQH31_RS02575 (EQH31_02760) | blpN | 503880..504083 (+) | 204 | WP_001099492.1 | two-peptide bacteriocin subunit BlpN | - |
| EQH31_RS02580 (EQH31_02770) | cipB | 504327..504476 (+) | 150 | WP_001818346.1 | bacteriocin-like peptide BlpO | Regulator |
| EQH31_RS02585 (EQH31_02775) | - | 504580..504699 (+) | 120 | WP_000346296.1 | PncF family bacteriocin immunity protein | - |
| EQH31_RS02590 (EQH31_02785) | - | 505485..505869 (+) | 385 | Protein_518 | immunity protein | - |
| EQH31_RS02595 (EQH31_02790) | - | 505921..506610 (+) | 690 | WP_000760515.1 | CPBP family intramembrane glutamic endopeptidase | - |
| EQH31_RS02600 (EQH31_02795) | blpZ | 506652..506900 (+) | 249 | WP_000276500.1 | immunity protein BlpZ | - |
| EQH31_RS02605 (EQH31_02800) | - | 506930..507541 (+) | 612 | WP_000394044.1 | CPBP family intramembrane glutamic endopeptidase | - |
| EQH31_RS02610 (EQH31_02805) | ccrZ | 507702..508496 (+) | 795 | WP_000363002.1 | cell cycle regulator CcrZ | - |
| EQH31_RS02615 (EQH31_02810) | trmB | 508493..509128 (+) | 636 | WP_001266083.1 | tRNA (guanosine(46)-N7)-methyltransferase TrmB | - |
Sequence
Protein
Download Length: 49 a.a. Molecular weight: 5134.91 Da Isoelectric Point: 3.9133
>NTDB_id=296444 EQH31_RS02580 WP_001818346.1 504327..504476(+) (cipB) [Streptococcus pneumoniae strain TVO_1901938]
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
Nucleotide
Download Length: 150 bp
>NTDB_id=296444 EQH31_RS02580 WP_001818346.1 504327..504476(+) (cipB) [Streptococcus pneumoniae strain TVO_1901938]
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| cipB | Streptococcus mutans UA159 |
51.02 |
100 |
0.51 |