Detailed information
Bioinformatically predicted
Overview
| Name | cipB | Type | Regulator |
| Locus tag | EQH32_RS02620 | Genome accession | NZ_CP035248 |
| Coordinates | 512377..512526 (+) | Length | 49 a.a. |
| NCBI ID | WP_001818346.1 | Uniprot ID | Q9FBH1 |
| Organism | Streptococcus pneumoniae strain TVO_1901939 | ||
| Function | indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation |
||
Genomic Context
Location: 507377..517526
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EQH32_RS10790 (EQH32_02720) | comA/nlmT | 507416..508003 (-) | 588 | WP_000205166.1 | cysteine peptidase family C39 domain-containing protein | Regulator |
| EQH32_RS02575 (EQH32_02725) | blpI | 508285..508482 (+) | 198 | WP_001093259.1 | bacteriocin-like peptide BlpI | - |
| EQH32_RS02580 (EQH32_02735) | blpJ | 508949..509218 (+) | 270 | WP_001093248.1 | bacteriocin-like peptide BlpJ | - |
| EQH32_RS02585 (EQH32_02740) | blpU | 509287..509517 (+) | 231 | WP_000379964.1 | bacteriocin-like peptide BlpU | - |
| EQH32_RS02590 (EQH32_02745) | - | 509520..509639 (+) | 120 | WP_001844187.1 | PncF family bacteriocin immunity protein | - |
| EQH32_RS02595 (EQH32_02750) | - | 509938..510102 (+) | 165 | WP_000727118.1 | hypothetical protein | - |
| EQH32_RS02600 (EQH32_02755) | - | 510099..510503 (+) | 405 | WP_000846570.1 | hypothetical protein | - |
| EQH32_RS02605 (EQH32_02760) | - | 510706..511510 (+) | 805 | WP_001105180.1 | IS5 family transposase | - |
| EQH32_RS02610 (EQH32_02765) | blpM | 511660..511914 (+) | 255 | WP_000379879.1 | two-peptide bacteriocin subunit BlpM | - |
| EQH32_RS02615 (EQH32_02770) | blpN | 511930..512133 (+) | 204 | WP_001099492.1 | two-peptide bacteriocin subunit BlpN | - |
| EQH32_RS02620 (EQH32_02780) | cipB | 512377..512526 (+) | 150 | WP_001818346.1 | bacteriocin-like peptide BlpO | Regulator |
| EQH32_RS02625 (EQH32_02785) | - | 512630..512749 (+) | 120 | WP_000346296.1 | PncF family bacteriocin immunity protein | - |
| EQH32_RS02630 (EQH32_02795) | - | 513535..513957 (+) | 423 | WP_238094680.1 | immunity protein | - |
| EQH32_RS02635 (EQH32_02800) | - | 513972..514661 (+) | 690 | WP_000760515.1 | CPBP family intramembrane glutamic endopeptidase | - |
| EQH32_RS02640 (EQH32_02805) | blpZ | 514703..514951 (+) | 249 | WP_000276500.1 | immunity protein BlpZ | - |
| EQH32_RS02645 (EQH32_02810) | - | 514981..515592 (+) | 612 | WP_000394044.1 | CPBP family intramembrane glutamic endopeptidase | - |
| EQH32_RS02650 (EQH32_02815) | ccrZ | 515753..516547 (+) | 795 | WP_000363002.1 | cell cycle regulator CcrZ | - |
| EQH32_RS02655 (EQH32_02820) | trmB | 516544..517179 (+) | 636 | WP_001266083.1 | tRNA (guanosine(46)-N7)-methyltransferase TrmB | - |
Sequence
Protein
Download Length: 49 a.a. Molecular weight: 5134.91 Da Isoelectric Point: 3.9133
>NTDB_id=296322 EQH32_RS02620 WP_001818346.1 512377..512526(+) (cipB) [Streptococcus pneumoniae strain TVO_1901939]
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
Nucleotide
Download Length: 150 bp
>NTDB_id=296322 EQH32_RS02620 WP_001818346.1 512377..512526(+) (cipB) [Streptococcus pneumoniae strain TVO_1901939]
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| cipB | Streptococcus mutans UA159 |
51.02 |
100 |
0.51 |