Detailed information
Bioinformatically predicted
Overview
| Name | cipB | Type | Regulator |
| Locus tag | EQH45_RS02715 | Genome accession | NZ_CP035235 |
| Coordinates | 536109..536258 (+) | Length | 49 a.a. |
| NCBI ID | WP_001818346.1 | Uniprot ID | Q9FBH1 |
| Organism | Streptococcus pneumoniae strain TVO_1902276 | ||
| Function | indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation |
||
Genomic Context
Location: 531109..541258
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EQH45_RS02670 (EQH45_02835) | blpI | 532021..532218 (+) | 198 | WP_001093259.1 | bacteriocin-like peptide BlpI | - |
| EQH45_RS02675 (EQH45_02845) | blpJ | 532684..532953 (+) | 270 | WP_001093249.1 | bacteriocin-like peptide BlpJ | - |
| EQH45_RS11145 (EQH45_02850) | cipB | 533022..533156 (+) | 135 | WP_128903586.1 | bacteriocin class II family protein | Regulator |
| EQH45_RS02680 | - | 533093..533251 (+) | 159 | WP_001849862.1 | hypothetical protein | - |
| EQH45_RS02685 (EQH45_02855) | - | 533254..533373 (+) | 120 | WP_000346298.1 | PncF family bacteriocin immunity protein | - |
| EQH45_RS02690 (EQH45_02860) | - | 533670..533834 (+) | 165 | WP_000727118.1 | hypothetical protein | - |
| EQH45_RS02695 (EQH45_02865) | - | 533831..534235 (+) | 405 | WP_000846943.1 | hypothetical protein | - |
| EQH45_RS02700 (EQH45_02870) | - | 534438..535242 (+) | 805 | WP_128903587.1 | IS5 family transposase | - |
| EQH45_RS02705 (EQH45_02875) | blpM | 535392..535646 (+) | 255 | WP_000379879.1 | two-peptide bacteriocin subunit BlpM | - |
| EQH45_RS02710 (EQH45_02880) | blpN | 535662..535865 (+) | 204 | WP_001099492.1 | two-peptide bacteriocin subunit BlpN | - |
| EQH45_RS02715 (EQH45_02890) | cipB | 536109..536258 (+) | 150 | WP_001818346.1 | bacteriocin-like peptide BlpO | Regulator |
| EQH45_RS11270 | - | 536294..536359 (+) | 66 | Protein_544 | ComC/BlpC family peptide pheromone/bacteriocin | - |
| EQH45_RS02720 (EQH45_02895) | - | 536362..536481 (+) | 120 | WP_000346296.1 | PncF family bacteriocin immunity protein | - |
| EQH45_RS02725 (EQH45_02905) | - | 537267..537650 (+) | 384 | WP_000877381.1 | hypothetical protein | - |
| EQH45_RS02730 (EQH45_02910) | - | 537702..538391 (+) | 690 | WP_000760529.1 | CPBP family intramembrane glutamic endopeptidase | - |
| EQH45_RS02735 (EQH45_02915) | blpZ | 538433..538666 (+) | 234 | WP_001849865.1 | immunity protein BlpZ | - |
| EQH45_RS02740 (EQH45_02925) | - | 538817..539428 (+) | 612 | WP_000394037.1 | CPBP family intramembrane glutamic endopeptidase | - |
| EQH45_RS02745 (EQH45_02930) | ccrZ | 539589..540383 (+) | 795 | WP_000363010.1 | cell cycle regulator CcrZ | - |
| EQH45_RS02750 (EQH45_02935) | trmB | 540380..541015 (+) | 636 | WP_001266078.1 | tRNA (guanosine(46)-N7)-methyltransferase TrmB | - |
Sequence
Protein
Download Length: 49 a.a. Molecular weight: 5134.91 Da Isoelectric Point: 3.9133
>NTDB_id=294902 EQH45_RS02715 WP_001818346.1 536109..536258(+) (cipB) [Streptococcus pneumoniae strain TVO_1902276]
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
Nucleotide
Download Length: 150 bp
>NTDB_id=294902 EQH45_RS02715 WP_001818346.1 536109..536258(+) (cipB) [Streptococcus pneumoniae strain TVO_1902276]
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| cipB | Streptococcus mutans UA159 |
51.02 |
100 |
0.51 |