Detailed information NTG0282783

Bioinformatically predicted

Overview

• Name: comGD
• Type: Machinery gene
• Locus tag: D9Y32_RS21045
• Genome accession: NZ_CP033218
• Coordinates: 4028356..4028793 (-)
• Length: 145 a.a.
• NCBI ID: WP_009327905.1
• Uniprot ID: Q8VQ70
• Organism: Bacillus licheniformis strain TCCC 11148
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 4023356..4033793

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
D9Y32_RS20995 (D9Y32_21020)	sinI	4023532..4023708 (+)	177	WP_003183444.1	anti-repressor SinI	Regulator
D9Y32_RS21000 (D9Y32_21025)	sinR	4023742..4024077 (+)	336	WP_006637528.1	transcriptional regulator SinR	Regulator
D9Y32_RS21005 (D9Y32_21030)	tasA	4024182..4024976 (-)	795	WP_142782737.1	biofilm matrix protein TasA	-
D9Y32_RS21010 (D9Y32_21035)	sipW	4025050..4025634 (-)	585	WP_003183449.1	signal peptidase I SipW	-
D9Y32_RS21015 (D9Y32_21040)	tapA	4025631..4026359 (-)	729	WP_003183451.1	amyloid fiber anchoring/assembly protein TapA	-
D9Y32_RS21020 (D9Y32_21045)	-	4026636..4026956 (+)	321	WP_003183454.1	YqzG/YhdC family protein	-
D9Y32_RS21025 (D9Y32_21050)	-	4026980..4027162 (-)	183	WP_003183456.1	YqzE family protein	-
D9Y32_RS21030 (D9Y32_21055)	comGG	4027250..4027615 (-)	366	WP_003183459.1	competence type IV pilus minor pilin ComGG	-
D9Y32_RS21035 (D9Y32_21060)	comGF	4027628..4028116 (-)	489	WP_011201694.1	competence type IV pilus minor pilin ComGF	-
D9Y32_RS21040 (D9Y32_21065)	comGE	4028025..4028372 (-)	348	WP_009327907.1	competence type IV pilus minor pilin ComGE	-
D9Y32_RS21045 (D9Y32_21070)	comGD	4028356..4028793 (-)	438	WP_009327905.1	competence type IV pilus minor pilin ComGD	Machinery gene
D9Y32_RS21050 (D9Y32_21075)	comGC	4028799..4029092 (-)	294	WP_003183466.1	competence type IV pilus major pilin ComGC	Machinery gene
D9Y32_RS21055 (D9Y32_21080)	comGB	4029106..4030140 (-)	1035	WP_011198115.1	competence type IV pilus assembly protein ComGB	Machinery gene
D9Y32_RS21060 (D9Y32_21085)	comGA	4030130..4031194 (-)	1065	WP_003183477.1	competence type IV pilus ATPase ComGA	Machinery gene
D9Y32_RS21065 (D9Y32_21090)	-	4031351..4032190 (-)	840	WP_061576836.1	STAS domain-containing protein	-
D9Y32_RS21075 (D9Y32_21100)	-	4032413..4032808 (-)	396	WP_142782738.1	Spx/MgsR family RNA polymerase-binding regulatory protein	-
D9Y32_RS21080 (D9Y32_21105)	-	4033017..4033262 (+)	246	WP_003183483.1	DUF2626 domain-containing protein	-

Sequence

Protein

• Length: 145 a.a.
• Molecular weight: 16249.07 Da
• Isoelectric Point: 9.6739

>NTDB_id=282783 D9Y32_RS21045 WP_009327905.1 4028356..4028793(-) (comGD) [Bacillus licheniformis strain TCCC 11148]
MNQKGFTLLESLTVLMIGSIMFSLLFALLPPIYEKRIVQHFVSQLEEDLLYAQQTALVRHTTVKVQFDFAGCRYIMKHSD
EGSSPELVRTYSCNIAIKKSTLKPILTFNPSGVPNQGGKIVIDTQHASFILTIYLGSGKINVQKK

Nucleotide

• Length: 438 bp

>NTDB_id=282783 D9Y32_RS21045 WP_009327905.1 4028356..4028793(-) (comGD) [Bacillus licheniformis strain TCCC 11148]
ATGAATCAAAAAGGATTTACGCTTTTGGAAAGTTTAACTGTATTGATGATCGGTTCTATTATGTTCTCTCTTCTCTTTGC
TCTACTGCCTCCCATTTATGAAAAAAGAATCGTTCAGCACTTTGTCTCACAGCTTGAAGAGGATTTGCTTTACGCTCAGC
AGACGGCTCTCGTCCGCCATACGACGGTTAAGGTGCAGTTTGACTTTGCCGGCTGCCGCTATATCATGAAGCATTCGGAC
GAAGGCTCATCGCCTGAACTGGTCAGGACATACAGCTGCAATATCGCAATCAAAAAGTCGACGCTCAAACCAATTCTTAC
TTTTAATCCAAGCGGTGTTCCGAATCAAGGGGGAAAGATCGTGATCGATACACAGCATGCCTCTTTTATACTGACGATCT
ATTTAGGAAGCGGAAAGATTAATGTTCAAAAAAAATAA

Domains

Predicted by InterProScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (2-25)

3D structure

• AlphaFold DB: Q8VQ70

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGD	Bacillus subtilis subsp. subtilis str. 168	39.86	98.621	0.393