Detailed information
Bioinformatically predicted
Overview
| Name | cipB | Type | Regulator |
| Locus tag | SPCG_RS02675 | Genome accession | NC_010582 |
| Coordinates | 505907..506056 (+) | Length | 49 a.a. |
| NCBI ID | WP_001813641.1 | Uniprot ID | - |
| Organism | Streptococcus pneumoniae CGSP14 | ||
| Function | indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation |
||
Genomic Context
Location: 500907..511056
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SPCG_RS02630 (SPCG_0502) | blpU | 502771..503001 (+) | 231 | WP_001093268.1 | bacteriocin-like peptide BlpU | - |
| SPCG_RS02635 | - | 503004..503123 (+) | 120 | WP_000346298.1 | PncF family bacteriocin immunity protein | - |
| SPCG_RS12065 | - | 503420..503584 (+) | 165 | WP_000727118.1 | hypothetical protein | - |
| SPCG_RS02650 (SPCG_0503) | - | 503581..503985 (+) | 405 | WP_000846944.1 | hypothetical protein | - |
| SPCG_RS12070 | - | 504183..504988 (+) | 806 | Protein_507 | IS5 family transposase | - |
| SPCG_RS02665 (SPCG_0506) | blpM | 505190..505444 (+) | 255 | WP_000379879.1 | two-peptide bacteriocin subunit BlpM | - |
| SPCG_RS02670 (SPCG_0507) | blpN | 505460..505663 (+) | 204 | WP_001099492.1 | two-peptide bacteriocin subunit BlpN | - |
| SPCG_RS02675 (SPCG_0508) | cipB | 505907..506056 (+) | 150 | WP_001813641.1 | bacteriocin-like peptide BlpO | Regulator |
| SPCG_RS02680 | - | 506160..506279 (+) | 120 | WP_000346296.1 | PncF family bacteriocin immunity protein | - |
| SPCG_RS02690 (SPCG_0509) | - | 507065..507448 (+) | 384 | WP_000877378.1 | hypothetical protein | - |
| SPCG_RS02695 (SPCG_0510) | - | 507500..508189 (+) | 690 | WP_000760541.1 | CPBP family intramembrane glutamic endopeptidase | - |
| SPCG_RS02700 (SPCG_0511) | blpZ | 508231..508464 (+) | 234 | WP_000276498.1 | immunity protein BlpZ | - |
| SPCG_RS02705 (SPCG_0512) | - | 508615..509226 (+) | 612 | WP_000394045.1 | CPBP family intramembrane glutamic endopeptidase | - |
| SPCG_RS02710 (SPCG_0513) | ccrZ | 509387..510181 (+) | 795 | WP_000363002.1 | cell cycle regulator CcrZ | - |
| SPCG_RS02715 (SPCG_0514) | trmB | 510178..510813 (+) | 636 | WP_001266075.1 | tRNA (guanosine(46)-N7)-methyltransferase TrmB | - |
Sequence
Protein
Download Length: 49 a.a. Molecular weight: 5164.93 Da Isoelectric Point: 3.9133
>NTDB_id=28189 SPCG_RS02675 WP_001813641.1 505907..506056(+) (cipB) [Streptococcus pneumoniae CGSP14]
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCTAGVAYGAIDGCATTV
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCTAGVAYGAIDGCATTV
Nucleotide
Download Length: 150 bp
>NTDB_id=28189 SPCG_RS02675 WP_001813641.1 505907..506056(+) (cipB) [Streptococcus pneumoniae CGSP14]
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTACAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTACAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| cipB | Streptococcus mutans UA159 |
48.98 |
100 |
0.49 |