Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   D4L56_RS07235 Genome accession   NZ_CP032898
Coordinates   1483470..1483583 (-) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   Q9ZEL1
Organism   Helicobacter pylori strain 479-C-EK2     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1478470..1488583
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D4L56_RS07215 - 1479139..1480551 (-) 1413 WP_139518910.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -
  D4L56_RS07220 comB10 1480621..1481757 (-) 1137 WP_139518911.1 DNA type IV secretion system protein ComB10 Machinery gene
  D4L56_RS07225 comB9 1481750..1482730 (-) 981 WP_139523771.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  D4L56_RS07230 comB8 1482730..1483473 (-) 744 WP_100959825.1 virB8 family protein Machinery gene
  D4L56_RS07235 comB7 1483470..1483583 (-) 114 WP_001217873.1 hypothetical protein Machinery gene
  D4L56_RS07240 comB6 1483599..1484654 (-) 1056 WP_139518913.1 type IV secretion system protein Machinery gene
  D4L56_RS07245 - 1484662..1485657 (-) 996 WP_139519045.1 PDZ domain-containing protein -
  D4L56_RS07250 - 1485657..1485959 (-) 303 WP_139518914.1 YbaB/EbfC family nucleoid-associated protein -
  D4L56_RS07255 panD 1485971..1486321 (-) 351 WP_108310021.1 aspartate 1-decarboxylase -
  D4L56_RS07260 - 1486311..1488536 (-) 2226 WP_139518915.1 ATP-dependent Clp protease ATP-binding subunit -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=280507 D4L56_RS07235 WP_001217873.1 1483470..1483583(-) (comB7) [Helicobacter pylori strain 479-C-EK2]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=280507 D4L56_RS07235 WP_001217873.1 1483470..1483583(-) (comB7) [Helicobacter pylori strain 479-C-EK2]
ATGAGAATTTTTTTTGTTATTATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACCTTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q9ZEL1

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1