Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   D2M30_RS12510 Genome accession   NZ_CP032146
Coordinates   2493245..2493418 (+) Length   57 a.a.
NCBI ID   WP_013352860.1    Uniprot ID   A0A9P1JIA1
Organism   Bacillus amyloliquefaciens strain YP6     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2488245..2498418
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D2M30_RS12495 (D2M30_12520) gcvT 2489056..2490156 (-) 1101 WP_125122953.1 glycine cleavage system aminomethyltransferase GcvT -
  D2M30_RS12500 (D2M30_12525) - 2490580..2492250 (+) 1671 WP_125122954.1 DEAD/DEAH box helicase -
  D2M30_RS12505 (D2M30_12530) - 2492271..2493065 (+) 795 WP_088613113.1 YqhG family protein -
  D2M30_RS12510 (D2M30_12535) sinI 2493245..2493418 (+) 174 WP_013352860.1 anti-repressor SinI Regulator
  D2M30_RS12515 (D2M30_12540) sinR 2493452..2493787 (+) 336 WP_014470659.1 transcriptional regulator SinR Regulator
  D2M30_RS12520 (D2M30_12545) tasA 2493835..2494620 (-) 786 WP_013352862.1 biofilm matrix protein TasA -
  D2M30_RS12525 (D2M30_12550) sipW 2494685..2495269 (-) 585 WP_125122955.1 signal peptidase I SipW -
  D2M30_RS12530 (D2M30_12555) tapA 2495241..2495912 (-) 672 WP_125122956.1 amyloid fiber anchoring/assembly protein TapA -
  D2M30_RS12535 (D2M30_12560) - 2496170..2496499 (+) 330 WP_013352865.1 DUF3889 domain-containing protein -
  D2M30_RS12540 (D2M30_12565) - 2496540..2496719 (-) 180 WP_016938971.1 YqzE family protein -
  D2M30_RS12545 (D2M30_12570) comGG 2496776..2497153 (-) 378 WP_071348016.1 competence type IV pilus minor pilin ComGG Machinery gene
  D2M30_RS12550 (D2M30_12575) comGF 2497155..2497559 (-) 405 WP_185715963.1 competence type IV pilus minor pilin ComGF Machinery gene
  D2M30_RS12555 (D2M30_12580) comGE 2497564..2497878 (-) 315 WP_125122957.1 competence type IV pilus minor pilin ComGE Machinery gene
  D2M30_RS12560 (D2M30_12585) comGD 2497862..2498299 (-) 438 WP_125122958.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6689.61 Da        Isoelectric Point: 9.8173

>NTDB_id=274844 D2M30_RS12510 WP_013352860.1 2493245..2493418(+) (sinI) [Bacillus amyloliquefaciens strain YP6]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLHSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=274844 D2M30_RS12510 WP_013352860.1 2493245..2493418(+) (sinI) [Bacillus amyloliquefaciens strain YP6]
ATGAAAAATGCAAAAACAGAGTTTTCGCAATTAGATAAGGAATGGGTTGAACTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAGATACGCAAATACCTGCATTCGCATAAAAAGTCTTCTCAACATATCCAGGCCGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A9P1JIA1

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

68.421

100

0.684


Multiple sequence alignment