Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | NWMN_RS08160 | Genome accession | NC_009641 |
| Coordinates | 1614748..1615059 (-) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | A0A0H2XGS7 |
| Organism | Staphylococcus aureus subsp. aureus str. Newman | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1609748..1620059
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NWMN_RS08125 (NWMN_1440) | gcvPA | 1610250..1611596 (-) | 1347 | WP_000019687.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
| NWMN_RS08130 (NWMN_1441) | gcvT | 1611616..1612707 (-) | 1092 | WP_000093349.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| NWMN_RS08135 (NWMN_1442) | - | 1612866..1613390 (-) | 525 | WP_001015117.1 | shikimate kinase | - |
| NWMN_RS08140 | - | 1613380..1613526 (-) | 147 | WP_001789879.1 | hypothetical protein | - |
| NWMN_RS08145 (NWMN_1443) | comGF | 1613623..1614120 (-) | 498 | WP_001789864.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| NWMN_RS08150 (NWMN_1444) | comGE | 1614038..1614337 (-) | 300 | WP_000844413.1 | hypothetical protein | Machinery gene |
| NWMN_RS08155 (NWMN_1445) | comGD | 1614324..1614770 (-) | 447 | WP_001790850.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| NWMN_RS08160 (NWMN_1446) | comGC | 1614748..1615059 (-) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| NWMN_RS08165 (NWMN_1447) | comGB | 1615073..1616143 (-) | 1071 | WP_000775708.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| NWMN_RS08170 (NWMN_1448) | comGA | 1616115..1617089 (-) | 975 | WP_000697228.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| NWMN_RS08175 (NWMN_1449) | - | 1617141..1617764 (-) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| NWMN_RS08180 (NWMN_1450) | - | 1617761..1618090 (-) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| NWMN_RS08185 (NWMN_1451) | - | 1618090..1619076 (-) | 987 | WP_000161314.1 | ROK family glucokinase | - |
| NWMN_RS08190 | - | 1619073..1619276 (-) | 204 | WP_000087561.1 | YqgQ family protein | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=26817 NWMN_RS08160 WP_000472256.1 1614748..1615059(-) (comGC) [Staphylococcus aureus subsp. aureus str. Newman]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=26817 NWMN_RS08160 WP_000472256.1 1614748..1615059(-) (comGC) [Staphylococcus aureus subsp. aureus str. Newman]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comGC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comGC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |