Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   DZN94_RS00680 Genome accession   NZ_CP031633
Coordinates   104159..104443 (+) Length   94 a.a.
NCBI ID   WP_011284422.1    Uniprot ID   -
Organism   Streptococcus pyogenes strain MGAS11115     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 99159..109443
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DZN94_RS00655 (DZN94_00655) - 101105..101470 (+) 366 WP_002986560.1 DUF1033 family protein -
  DZN94_RS00660 (DZN94_00660) comGA 101563..102501 (+) 939 WP_011284420.1 competence type IV pilus ATPase ComGA Machinery gene
  DZN94_RS00665 (DZN94_00665) comGB 102437..103471 (+) 1035 WP_227868694.1 competence type IV pilus assembly protein ComGB Machinery gene
  DZN94_RS00670 (DZN94_00670) comGC 103473..103799 (+) 327 WP_002986552.1 competence type IV pilus major pilin ComGC Machinery gene
  DZN94_RS00675 (DZN94_00675) comGD 103774..104202 (+) 429 WP_002986548.1 competence type IV pilus minor pilin ComGD Machinery gene
  DZN94_RS00680 (DZN94_00680) comGE 104159..104443 (+) 285 WP_011284422.1 competence type IV pilus minor pilin ComGE Machinery gene
  DZN94_RS00685 (DZN94_00685) comGF 104436..104870 (+) 435 WP_002992738.1 competence type IV pilus minor pilin ComGF Machinery gene
  DZN94_RS00690 (DZN94_00690) comGG 104854..105180 (+) 327 WP_010921801.1 competence type IV pilus minor pilin ComGG -
  DZN94_RS00695 (DZN94_00695) comGH 105278..106231 (+) 954 WP_010921802.1 class I SAM-dependent methyltransferase Machinery gene
  DZN94_RS00700 (DZN94_00700) - 106290..107486 (+) 1197 WP_011284424.1 acetate kinase -
  DZN94_RS00705 (DZN94_00705) - 107673..107981 (+) 309 WP_011284425.1 hypothetical protein -
  DZN94_RS00710 (DZN94_00710) proC 108064..108834 (-) 771 WP_011284426.1 pyrroline-5-carboxylate reductase -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10654.59 Da        Isoelectric Point: 8.9043

>NTDB_id=267975 DZN94_RS00680 WP_011284422.1 104159..104443(+) (comGE) [Streptococcus pyogenes strain MGAS11115]
MGIIKKQVKAYIALESMIATGILFSIVILVLSSLQQSQAALTYYRKQQEKLNLALMAVQTRTKEITLNGCHITILRTDRY
ISIHDDEGEVMKIE

Nucleotide


Download         Length: 285 bp        

>NTDB_id=267975 DZN94_RS00680 WP_011284422.1 104159..104443(+) (comGE) [Streptococcus pyogenes strain MGAS11115]
GTGGGAATTATCAAAAAACAAGTCAAAGCTTACATAGCCCTTGAAAGTATGATCGCAACAGGCATCCTCTTTAGTATTGT
CATTCTCGTCTTAAGCAGTTTACAGCAGAGTCAGGCTGCTCTAACGTACTATCGAAAGCAGCAAGAAAAGCTTAATCTAG
CCTTGATGGCAGTACAAACTAGAACTAAAGAGATAACATTGAATGGTTGTCATATTACTATTTTACGTACGGATAGATAC
ATTAGTATTCACGATGACGAAGGAGAAGTGATGAAGATTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Lactococcus lactis subsp. cremoris KW2

38.298

100

0.383