Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   DV130_RS05095 Genome accession   NZ_CP031248
Coordinates   977175..977324 (-) Length   49 a.a.
NCBI ID   WP_001818346.1    Uniprot ID   Q9FBH1
Organism   Streptococcus pneumoniae strain M26365     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context

Location: 972175..982324
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DV130_RS05050 trmB 972417..973052 (-) 636 WP_001266078.1 tRNA (guanosine(46)-N7)-methyltransferase TrmB -
  DV130_RS05055 - 973049..973843 (-) 795 WP_000363002.1 phosphotransferase family protein -
  DV130_RS05060 - 974005..974616 (-) 612 WP_000394030.1 type II CAAX endopeptidase family protein -
  DV130_RS05070 blpZ 974767..975000 (-) 234 WP_000276498.1 immunity protein BlpZ -
  DV130_RS05075 - 975042..975731 (-) 690 WP_000760515.1 CPBP family intramembrane glutamic endopeptidase -
  DV130_RS05080 - 975783..976166 (-) 384 WP_000877381.1 hypothetical protein -
  DV130_RS05090 - 976952..977071 (-) 120 WP_000346296.1 PncF family bacteriocin immunity protein -
  DV130_RS05095 cipB 977175..977324 (-) 150 WP_001818346.1 bacteriocin-like peptide BlpO Regulator
  DV130_RS05105 blpN 977568..977771 (-) 204 WP_001099492.1 two-peptide bacteriocin subunit BlpN -
  DV130_RS05110 blpM 977787..978041 (-) 255 WP_000379879.1 two-peptide bacteriocin subunit BlpM -
  DV130_RS05115 - 978191..978976 (-) 786 Protein_994 IS5 family transposase -
  DV130_RS05120 - 979179..979583 (-) 405 WP_000846943.1 hypothetical protein -
  DV130_RS12180 - 979580..979744 (-) 165 WP_000727118.1 hypothetical protein -
  DV130_RS05130 - 980041..980160 (-) 120 WP_000346298.1 PncF family bacteriocin immunity protein -
  DV130_RS05135 blpU 980163..980393 (-) 231 WP_000379967.1 bacteriocin-like peptide BlpU -
  DV130_RS05140 blpJ 980462..980731 (-) 270 WP_001093248.1 bacteriocin-like peptide BlpJ -
  DV130_RS05150 blpI 981198..981395 (-) 198 WP_001093259.1 bacteriocin-like peptide BlpI -
  DV130_RS12850 comA/nlmT 981677..982264 (+) 588 WP_050088117.1 cysteine peptidase family C39 domain-containing protein Regulator

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5134.91 Da        Isoelectric Point: 3.9133

>NTDB_id=263366 DV130_RS05095 WP_001818346.1 977175..977324(-) (cipB) [Streptococcus pneumoniae strain M26365]
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=263366 DV130_RS05095 WP_001818346.1 977175..977324(-) (cipB) [Streptococcus pneumoniae strain M26365]
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterProScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-44)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB Q9FBH1

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

51.02

100

0.51