Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | CWQ21_RS03575 | Genome accession | NZ_CP025028 |
| Coordinates | 619558..619746 (+) | Length | 62 a.a. |
| NCBI ID | WP_000027835.1 | Uniprot ID | A0AAV3JNT7 |
| Organism | Streptococcus agalactiae strain SGEHI2015-95 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 610774..619516 | 619558..619746 | flank | 42 |
| IS/Tn | 618491..619102 | 619558..619746 | flank | 456 |
Gene organization within MGE regions
Location: 610774..619746
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CWQ21_RS03535 (CWQ21_03535) | - | 612153..612314 (-) | 162 | WP_000508795.1 | NINE protein | - |
| CWQ21_RS03540 (CWQ21_03540) | - | 613056..614333 (+) | 1278 | WP_000594360.1 | ABC transporter permease | - |
| CWQ21_RS03545 (CWQ21_03545) | - | 614343..614999 (+) | 657 | WP_000353149.1 | ABC transporter ATP-binding protein | - |
| CWQ21_RS03550 (CWQ21_03550) | - | 614999..616375 (+) | 1377 | WP_017647836.1 | FtsX-like permease family protein | - |
| CWQ21_RS03555 (CWQ21_03555) | - | 616472..617125 (+) | 654 | WP_000699093.1 | response regulator transcription factor | - |
| CWQ21_RS03560 (CWQ21_03560) | - | 617122..618439 (+) | 1318 | Protein_604 | HAMP domain-containing sensor histidine kinase | - |
| CWQ21_RS03565 (CWQ21_03565) | - | 618491..619138 (-) | 648 | Protein_605 | IS3 family transposase | - |
| CWQ21_RS03570 (CWQ21_03570) | - | 619316..619516 (+) | 201 | WP_000076708.1 | CsbD family protein | - |
| CWQ21_RS03575 (CWQ21_03575) | prx | 619558..619746 (+) | 189 | WP_000027835.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7180.25 Da Isoelectric Point: 4.7815
>NTDB_id=257380 CWQ21_RS03575 WP_000027835.1 619558..619746(+) (prx) [Streptococcus agalactiae strain SGEHI2015-95]
MSIRTDIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLLHEEVREEEVVTVERVLDVLRKLS
MSIRTDIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLLHEEVREEEVVTVERVLDVLRKLS
Nucleotide
Download Length: 189 bp
>NTDB_id=257380 CWQ21_RS03575 WP_000027835.1 619558..619746(+) (prx) [Streptococcus agalactiae strain SGEHI2015-95]
TTGTCTATCAGAACAGATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGT
GCGTAAAAACGGAAAGATATTTGATTATGTGTTACTACACGAAGAAGTGAGAGAAGAAGAGGTTGTTACAGTTGAGAGAG
TGCTTGATGTACTGAGGAAGTTATCATAA
TTGTCTATCAGAACAGATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGT
GCGTAAAAACGGAAAGATATTTGATTATGTGTTACTACACGAAGAAGTGAGAGAAGAAGAGGTTGTTACAGTTGAGAGAG
TGCTTGATGTACTGAGGAAGTTATCATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
72.222 |
87.097 |
0.629 |
| prx | Streptococcus pyogenes MGAS8232 |
69.091 |
88.71 |
0.613 |
| prx | Streptococcus pyogenes MGAS315 |
66.667 |
87.097 |
0.581 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
64.516 |
0.548 |
| prx | Streptococcus pyogenes MGAS315 |
61.818 |
88.71 |
0.548 |
| prx | Streptococcus pyogenes MGAS315 |
74.359 |
62.903 |
0.468 |
| prx | Streptococcus pyogenes MGAS315 |
78.378 |
59.677 |
0.468 |