Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   CV730_RS00965 Genome accession   NZ_CP024946
Coordinates   197967..198080 (+) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   G2MCV1
Organism   Helicobacter pylori strain B147     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 192967..203080
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CV730_RS00940 (CV730_00935) - 193029..195254 (+) 2226 WP_145728137.1 ATP-dependent Clp protease ATP-binding subunit -
  CV730_RS00945 (CV730_00940) panD 195244..195588 (+) 345 WP_145728138.1 aspartate 1-decarboxylase -
  CV730_RS00950 (CV730_00945) - 195600..195893 (+) 294 WP_000347917.1 YbaB/EbfC family nucleoid-associated protein -
  CV730_RS00955 (CV730_00950) - 195893..196888 (+) 996 WP_145729126.1 PDZ domain-containing protein -
  CV730_RS00960 (CV730_00955) comB6 196896..197951 (+) 1056 WP_145729124.1 P-type conjugative transfer protein TrbL Machinery gene
  CV730_RS00965 (CV730_00960) comB7 197967..198080 (+) 114 WP_001217873.1 hypothetical protein Machinery gene
  CV730_RS00970 (CV730_00965) comB8 198077..198820 (+) 744 WP_120832951.1 virB8 family protein Machinery gene
  CV730_RS00975 (CV730_00970) comB9 198820..199800 (+) 981 WP_145728139.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  CV730_RS00980 (CV730_00975) comB10 199793..200923 (+) 1131 WP_145728140.1 DNA type IV secretion system protein ComB10 Machinery gene
  CV730_RS00985 (CV730_00980) - 200993..202411 (+) 1419 WP_145728141.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=256534 CV730_RS00965 WP_001217873.1 197967..198080(+) (comB7) [Helicobacter pylori strain B147]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=256534 CV730_RS00965 WP_001217873.1 197967..198080(+) (comB7) [Helicobacter pylori strain B147]
ATGAGAATTTTTTTTGTTATTATGGGACTTGTGTTTTTTGGTTGCACGAGCAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACCTTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G2MCV1

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1


Multiple sequence alignment