Detailed information
Overview
| Name | abrB | Type | Regulator |
| Locus tag | CSE15_RS00255 | Genome accession | NZ_CP024204 |
| Coordinates | 47030..47320 (-) | Length | 96 a.a. |
| NCBI ID | WP_087975202.1 | Uniprot ID | - |
| Organism | Bacillus altitudinis strain P-10 | ||
| Function | repression of comK; repression of rok (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1538..81438 | 47030..47320 | within | 0 |
Gene organization within MGE regions
Location: 1538..81438
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CSE15_RS00010 (CSE15_00010) | dnaN | 1538..2674 (+) | 1137 | WP_008347596.1 | DNA polymerase III subunit beta | - |
| CSE15_RS00015 (CSE15_00015) | yaaA | 2825..3040 (+) | 216 | WP_008347598.1 | S4 domain-containing protein YaaA | - |
| CSE15_RS00020 (CSE15_00020) | recF | 3057..4169 (+) | 1113 | WP_017368464.1 | DNA replication/repair protein RecF | Machinery gene |
| CSE15_RS00025 (CSE15_00025) | remB | 4187..4432 (+) | 246 | WP_008347601.1 | extracellular matrix regulator RemB | - |
| CSE15_RS00030 (CSE15_00030) | gyrB | 4490..6406 (+) | 1917 | WP_025206585.1 | DNA topoisomerase (ATP-hydrolyzing) subunit B | - |
| CSE15_RS00035 (CSE15_00035) | gyrA | 6640..9135 (+) | 2496 | WP_058214360.1 | DNA gyrase subunit A | - |
| CSE15_RS00065 (CSE15_00065) | - | 14521..15489 (-) | 969 | WP_039962409.1 | YaaC family protein | - |
| CSE15_RS00070 (CSE15_00070) | guaB | 15611..17077 (+) | 1467 | WP_008342039.1 | IMP dehydrogenase | - |
| CSE15_RS00075 (CSE15_00075) | - | 17238..18563 (+) | 1326 | WP_008342036.1 | D-alanyl-D-alanine carboxypeptidase family protein | - |
| CSE15_RS00080 (CSE15_00080) | - | 18605..20083 (-) | 1479 | WP_008342034.1 | PLP-dependent aminotransferase family protein | - |
| CSE15_RS00085 (CSE15_00085) | pdxS | 20330..21214 (+) | 885 | WP_039170343.1 | pyridoxal 5'-phosphate synthase lyase subunit PdxS | - |
| CSE15_RS00090 (CSE15_00090) | pdxT | 21235..21825 (+) | 591 | WP_065461496.1 | pyridoxal 5'-phosphate synthase glutaminase subunit PdxT | - |
| CSE15_RS00095 (CSE15_00095) | serS | 22143..23417 (+) | 1275 | WP_008342028.1 | serine--tRNA ligase | - |
| CSE15_RS20140 | - | 24014..24346 (+) | 333 | Protein_14 | methyl-accepting chemotaxis protein | - |
| CSE15_RS00110 (CSE15_00110) | - | 24655..25314 (-) | 660 | WP_017366699.1 | deoxynucleoside kinase | - |
| CSE15_RS00115 (CSE15_00115) | - | 25311..25934 (-) | 624 | WP_017366700.1 | deoxynucleoside kinase | - |
| CSE15_RS00120 (CSE15_00120) | - | 26014..27261 (-) | 1248 | WP_231947239.1 | glycoside hydrolase family 18 protein | - |
| CSE15_RS00125 (CSE15_00125) | - | 27361..27915 (-) | 555 | WP_060831987.1 | isochorismatase family cysteine hydrolase | - |
| CSE15_RS00130 (CSE15_00130) | tadA | 27995..28471 (+) | 477 | WP_008342015.1 | tRNA adenosine(34) deaminase TadA | - |
| CSE15_RS00140 (CSE15_00140) | dnaX | 29143..30855 (+) | 1713 | WP_065461502.1 | DNA polymerase III subunit gamma/tau | - |
| CSE15_RS00145 (CSE15_00145) | - | 30881..31204 (+) | 324 | WP_008342011.1 | YbaB/EbfC family nucleoid-associated protein | - |
| CSE15_RS00150 (CSE15_00150) | recR | 31220..31816 (+) | 597 | WP_003218094.1 | recombination protein RecR | - |
| CSE15_RS00155 (CSE15_00155) | - | 31835..32059 (+) | 225 | WP_008342008.1 | YaaL family protein | - |
| CSE15_RS00160 (CSE15_00160) | - | 32126..32389 (+) | 264 | WP_008342006.1 | pro-sigmaK processing inhibitor BofA family protein | - |
| CSE15_RS00190 (CSE15_00190) | - | 37847..38038 (+) | 192 | WP_017359334.1 | sigma factor G inhibitor Gin | - |
| CSE15_RS00195 (CSE15_00195) | - | 38167..38781 (+) | 615 | WP_046342403.1 | 5-bromo-4-chloroindolyl phosphate hydrolysis family protein | - |
| CSE15_RS00200 (CSE15_00200) | - | 38803..39864 (+) | 1062 | WP_099496223.1 | toxic anion resistance protein | - |
| CSE15_RS00205 (CSE15_00205) | - | 39942..41348 (+) | 1407 | WP_099496224.1 | aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme | - |
| CSE15_RS00210 (CSE15_00210) | tmk | 41345..41983 (+) | 639 | WP_017366431.1 | dTMP kinase | - |
| CSE15_RS00215 (CSE15_00215) | - | 42063..42392 (+) | 330 | WP_012008640.1 | cyclic-di-AMP receptor | - |
| CSE15_RS00220 (CSE15_00220) | - | 42405..42845 (+) | 441 | WP_008341898.1 | YaaR family protein | - |
| CSE15_RS00225 (CSE15_00225) | holB | 42857..43846 (+) | 990 | WP_017359329.1 | DNA polymerase III subunit delta' | - |
| CSE15_RS00230 (CSE15_00230) | - | 43849..44676 (+) | 828 | WP_007496230.1 | stage 0 sporulation family protein | - |
| CSE15_RS00235 (CSE15_00235) | yabA | 44691..45044 (+) | 354 | WP_007496228.1 | DNA replication initiation control protein YabA | - |
| CSE15_RS00240 (CSE15_00240) | - | 45100..45843 (+) | 744 | WP_017359328.1 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | - |
| CSE15_RS00245 (CSE15_00245) | - | 45830..46129 (+) | 300 | WP_019744059.1 | GIY-YIG nuclease family protein | - |
| CSE15_RS00250 (CSE15_00250) | rsmI | 46104..46985 (+) | 882 | WP_008341890.1 | 16S rRNA (cytidine(1402)-2'-O)-methyltransferase | - |
| CSE15_RS00255 (CSE15_00255) | abrB | 47030..47320 (-) | 291 | WP_087975202.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Regulator |
| CSE15_RS00265 (CSE15_00265) | metG | 47840..49840 (+) | 2001 | WP_035704074.1 | methionine--tRNA ligase | - |
| CSE15_RS00270 (CSE15_00270) | - | 49922..50689 (+) | 768 | WP_017359325.1 | TatD family hydrolase | - |
| CSE15_RS00275 (CSE15_00275) | - | 50934..52136 (+) | 1203 | WP_072368356.1 | G5 and 3D domain-containing protein | - |
| CSE15_RS00280 (CSE15_00280) | rnmV | 52297..52856 (+) | 560 | Protein_42 | ribonuclease M5 | - |
| CSE15_RS00285 (CSE15_00285) | rsmA | 52849..53727 (+) | 879 | WP_008341873.1 | 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA | - |
| CSE15_RS00290 (CSE15_00290) | yabG | 53985..54869 (+) | 885 | WP_007496216.1 | sporulation peptidase YabG | - |
| CSE15_RS00295 (CSE15_00295) | veg | 55083..55340 (+) | 258 | WP_003217979.1 | biofilm formation stimulator Veg | - |
| CSE15_RS00300 (CSE15_00300) | - | 55503..55688 (+) | 186 | WP_017366434.1 | small, acid-soluble spore protein, alpha/beta type | - |
| CSE15_RS00305 (CSE15_00305) | ispE | 55836..56705 (+) | 870 | WP_019743558.1 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | - |
| CSE15_RS00310 (CSE15_00310) | purR | 56761..57594 (+) | 834 | WP_008341862.1 | pur operon repressor | - |
| CSE15_RS00315 (CSE15_00315) | ridA | 57633..58010 (+) | 378 | WP_008341860.1 | 2-iminobutanoate/2-iminopropanoate deaminase | - |
| CSE15_RS00320 (CSE15_00320) | spoVG | 58235..58531 (+) | 297 | WP_008357439.1 | septation regulator SpoVG | - |
| CSE15_RS00325 (CSE15_00325) | glmU | 58730..60100 (+) | 1371 | WP_099496225.1 | bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU | - |
| CSE15_RS00330 (CSE15_00330) | - | 60123..61076 (+) | 954 | WP_003217907.1 | ribose-phosphate diphosphokinase | - |
| CSE15_RS00335 (CSE15_00335) | - | 61215..61841 (+) | 627 | WP_008341853.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
| CSE15_RS00340 (CSE15_00340) | pth | 61982..62548 (+) | 567 | WP_024719358.1 | aminoacyl-tRNA hydrolase | - |
| CSE15_RS00345 (CSE15_00345) | - | 62604..62834 (+) | 231 | WP_003217967.1 | anti-sigma-F factor Fin family protein | - |
| CSE15_RS00350 (CSE15_00350) | mfd | 62902..66435 (+) | 3534 | WP_099496226.1 | transcription-repair coupling factor | - |
| CSE15_RS00355 (CSE15_00355) | spoVT | 66575..67111 (+) | 537 | WP_007496196.1 | stage V sporulation protein T | - |
| CSE15_RS00360 (CSE15_00360) | - | 67316..68920 (+) | 1605 | WP_099496227.1 | polysaccharide biosynthesis protein | - |
| CSE15_RS00365 (CSE15_00365) | mazG | 68910..70394 (+) | 1485 | WP_099496228.1 | nucleoside triphosphate pyrophosphohydrolase | - |
| CSE15_RS00370 (CSE15_00370) | - | 70391..70651 (+) | 261 | WP_099496229.1 | RNA-binding S4 domain-containing protein | - |
| CSE15_RS00375 (CSE15_00375) | yabP | 70726..71034 (+) | 309 | WP_007496190.1 | sporulation protein YabP | - |
| CSE15_RS00380 (CSE15_00380) | yabQ | 71031..71669 (+) | 639 | WP_099496230.1 | spore cortex biosynthesis protein YabQ | - |
| CSE15_RS00385 (CSE15_00385) | - | 71688..72062 (+) | 375 | WP_007496186.1 | FtsB family cell division protein | - |
| CSE15_RS00390 (CSE15_00390) | - | 72145..72543 (+) | 399 | WP_003217901.1 | S1 domain-containing RNA-binding protein | - |
| CSE15_RS00405 (CSE15_00405) | spoIIE | 73096..75579 (+) | 2484 | WP_099496231.1 | stage II sporulation protein E | - |
| CSE15_RS00410 (CSE15_00410) | - | 75656..76390 (+) | 735 | WP_008341829.1 | vWA domain-containing protein | - |
| CSE15_RS00415 (CSE15_00415) | - | 76374..77383 (+) | 1010 | Protein_67 | protein kinase domain-containing protein | - |
| CSE15_RS00420 (CSE15_00420) | tilS | 77480..78902 (+) | 1423 | Protein_68 | tRNA lysidine(34) synthetase TilS | - |
| CSE15_RS00425 (CSE15_00425) | hpt | 78899..79438 (+) | 540 | WP_007496175.1 | hypoxanthine phosphoribosyltransferase | - |
| CSE15_RS00430 (CSE15_00430) | ftsH | 79534..81438 (+) | 1905 | WP_007496173.1 | ATP-dependent zinc metalloprotease FtsH | - |
Sequence
Protein
Download Length: 96 a.a. Molecular weight: 10853.65 Da Isoelectric Point: 7.9655
>NTDB_id=252944 CSE15_RS00255 WP_087975202.1 47030..47320(-) (abrB) [Bacillus altitudinis strain P-10]
MKMKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIILKKYKPNMTCQVTGEVSDDNLKLANGKLVLSREG
AEQIINEIQNQLQSQK
MKMKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIILKKYKPNMTCQVTGEVSDDNLKLANGKLVLSREG
AEQIINEIQNQLQSQK
Nucleotide
Download Length: 291 bp
>NTDB_id=252944 CSE15_RS00255 WP_087975202.1 47030..47320(-) (abrB) [Bacillus altitudinis strain P-10]
ATGAAGATGAAATCTACAGGTATTGTACGTAAAGTTGACGAATTAGGACGCGTGGTGATTCCAATCGAGCTTCGCCGTAC
GTTAGGAATCGCAGAAAAAGACGCTTTGGAAATTTATGTTGATGATGAAAAAATTATCCTAAAAAAATATAAACCAAACA
TGACTTGCCAAGTAACAGGTGAAGTATCAGACGATAACCTTAAACTTGCTAATGGTAAATTAGTTCTTAGCCGTGAAGGT
GCAGAGCAAATCATTAACGAAATCCAAAACCAACTTCAATCACAAAAATAA
ATGAAGATGAAATCTACAGGTATTGTACGTAAAGTTGACGAATTAGGACGCGTGGTGATTCCAATCGAGCTTCGCCGTAC
GTTAGGAATCGCAGAAAAAGACGCTTTGGAAATTTATGTTGATGATGAAAAAATTATCCTAAAAAAATATAAACCAAACA
TGACTTGCCAAGTAACAGGTGAAGTATCAGACGATAACCTTAAACTTGCTAATGGTAAATTAGTTCTTAGCCGTGAAGGT
GCAGAGCAAATCATTAACGAAATCCAAAACCAACTTCAATCACAAAAATAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| abrB | Bacillus subtilis subsp. subtilis str. 168 |
93.75 |
100 |
0.938 |