Detailed information    

insolico Bioinformatically predicted

Overview


Name   abrB   Type   Regulator
Locus tag   CSE15_RS00255 Genome accession   NZ_CP024204
Coordinates   47030..47320 (-) Length   96 a.a.
NCBI ID   WP_087975202.1    Uniprot ID   -
Organism   Bacillus altitudinis strain P-10     
Function   repression of comK; repression of rok (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1538..81438 47030..47320 within 0


Gene organization within MGE regions


Location: 1538..81438
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CSE15_RS00010 (CSE15_00010) dnaN 1538..2674 (+) 1137 WP_008347596.1 DNA polymerase III subunit beta -
  CSE15_RS00015 (CSE15_00015) yaaA 2825..3040 (+) 216 WP_008347598.1 S4 domain-containing protein YaaA -
  CSE15_RS00020 (CSE15_00020) recF 3057..4169 (+) 1113 WP_017368464.1 DNA replication/repair protein RecF Machinery gene
  CSE15_RS00025 (CSE15_00025) remB 4187..4432 (+) 246 WP_008347601.1 extracellular matrix regulator RemB -
  CSE15_RS00030 (CSE15_00030) gyrB 4490..6406 (+) 1917 WP_025206585.1 DNA topoisomerase (ATP-hydrolyzing) subunit B -
  CSE15_RS00035 (CSE15_00035) gyrA 6640..9135 (+) 2496 WP_058214360.1 DNA gyrase subunit A -
  CSE15_RS00065 (CSE15_00065) - 14521..15489 (-) 969 WP_039962409.1 YaaC family protein -
  CSE15_RS00070 (CSE15_00070) guaB 15611..17077 (+) 1467 WP_008342039.1 IMP dehydrogenase -
  CSE15_RS00075 (CSE15_00075) - 17238..18563 (+) 1326 WP_008342036.1 D-alanyl-D-alanine carboxypeptidase family protein -
  CSE15_RS00080 (CSE15_00080) - 18605..20083 (-) 1479 WP_008342034.1 PLP-dependent aminotransferase family protein -
  CSE15_RS00085 (CSE15_00085) pdxS 20330..21214 (+) 885 WP_039170343.1 pyridoxal 5'-phosphate synthase lyase subunit PdxS -
  CSE15_RS00090 (CSE15_00090) pdxT 21235..21825 (+) 591 WP_065461496.1 pyridoxal 5'-phosphate synthase glutaminase subunit PdxT -
  CSE15_RS00095 (CSE15_00095) serS 22143..23417 (+) 1275 WP_008342028.1 serine--tRNA ligase -
  CSE15_RS20140 - 24014..24346 (+) 333 Protein_14 methyl-accepting chemotaxis protein -
  CSE15_RS00110 (CSE15_00110) - 24655..25314 (-) 660 WP_017366699.1 deoxynucleoside kinase -
  CSE15_RS00115 (CSE15_00115) - 25311..25934 (-) 624 WP_017366700.1 deoxynucleoside kinase -
  CSE15_RS00120 (CSE15_00120) - 26014..27261 (-) 1248 WP_231947239.1 glycoside hydrolase family 18 protein -
  CSE15_RS00125 (CSE15_00125) - 27361..27915 (-) 555 WP_060831987.1 isochorismatase family cysteine hydrolase -
  CSE15_RS00130 (CSE15_00130) tadA 27995..28471 (+) 477 WP_008342015.1 tRNA adenosine(34) deaminase TadA -
  CSE15_RS00140 (CSE15_00140) dnaX 29143..30855 (+) 1713 WP_065461502.1 DNA polymerase III subunit gamma/tau -
  CSE15_RS00145 (CSE15_00145) - 30881..31204 (+) 324 WP_008342011.1 YbaB/EbfC family nucleoid-associated protein -
  CSE15_RS00150 (CSE15_00150) recR 31220..31816 (+) 597 WP_003218094.1 recombination protein RecR -
  CSE15_RS00155 (CSE15_00155) - 31835..32059 (+) 225 WP_008342008.1 YaaL family protein -
  CSE15_RS00160 (CSE15_00160) - 32126..32389 (+) 264 WP_008342006.1 pro-sigmaK processing inhibitor BofA family protein -
  CSE15_RS00190 (CSE15_00190) - 37847..38038 (+) 192 WP_017359334.1 sigma factor G inhibitor Gin -
  CSE15_RS00195 (CSE15_00195) - 38167..38781 (+) 615 WP_046342403.1 5-bromo-4-chloroindolyl phosphate hydrolysis family protein -
  CSE15_RS00200 (CSE15_00200) - 38803..39864 (+) 1062 WP_099496223.1 toxic anion resistance protein -
  CSE15_RS00205 (CSE15_00205) - 39942..41348 (+) 1407 WP_099496224.1 aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme -
  CSE15_RS00210 (CSE15_00210) tmk 41345..41983 (+) 639 WP_017366431.1 dTMP kinase -
  CSE15_RS00215 (CSE15_00215) - 42063..42392 (+) 330 WP_012008640.1 cyclic-di-AMP receptor -
  CSE15_RS00220 (CSE15_00220) - 42405..42845 (+) 441 WP_008341898.1 YaaR family protein -
  CSE15_RS00225 (CSE15_00225) holB 42857..43846 (+) 990 WP_017359329.1 DNA polymerase III subunit delta' -
  CSE15_RS00230 (CSE15_00230) - 43849..44676 (+) 828 WP_007496230.1 stage 0 sporulation family protein -
  CSE15_RS00235 (CSE15_00235) yabA 44691..45044 (+) 354 WP_007496228.1 DNA replication initiation control protein YabA -
  CSE15_RS00240 (CSE15_00240) - 45100..45843 (+) 744 WP_017359328.1 tRNA1(Val) (adenine(37)-N6)-methyltransferase -
  CSE15_RS00245 (CSE15_00245) - 45830..46129 (+) 300 WP_019744059.1 GIY-YIG nuclease family protein -
  CSE15_RS00250 (CSE15_00250) rsmI 46104..46985 (+) 882 WP_008341890.1 16S rRNA (cytidine(1402)-2'-O)-methyltransferase -
  CSE15_RS00255 (CSE15_00255) abrB 47030..47320 (-) 291 WP_087975202.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Regulator
  CSE15_RS00265 (CSE15_00265) metG 47840..49840 (+) 2001 WP_035704074.1 methionine--tRNA ligase -
  CSE15_RS00270 (CSE15_00270) - 49922..50689 (+) 768 WP_017359325.1 TatD family hydrolase -
  CSE15_RS00275 (CSE15_00275) - 50934..52136 (+) 1203 WP_072368356.1 G5 and 3D domain-containing protein -
  CSE15_RS00280 (CSE15_00280) rnmV 52297..52856 (+) 560 Protein_42 ribonuclease M5 -
  CSE15_RS00285 (CSE15_00285) rsmA 52849..53727 (+) 879 WP_008341873.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
  CSE15_RS00290 (CSE15_00290) yabG 53985..54869 (+) 885 WP_007496216.1 sporulation peptidase YabG -
  CSE15_RS00295 (CSE15_00295) veg 55083..55340 (+) 258 WP_003217979.1 biofilm formation stimulator Veg -
  CSE15_RS00300 (CSE15_00300) - 55503..55688 (+) 186 WP_017366434.1 small, acid-soluble spore protein, alpha/beta type -
  CSE15_RS00305 (CSE15_00305) ispE 55836..56705 (+) 870 WP_019743558.1 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase -
  CSE15_RS00310 (CSE15_00310) purR 56761..57594 (+) 834 WP_008341862.1 pur operon repressor -
  CSE15_RS00315 (CSE15_00315) ridA 57633..58010 (+) 378 WP_008341860.1 2-iminobutanoate/2-iminopropanoate deaminase -
  CSE15_RS00320 (CSE15_00320) spoVG 58235..58531 (+) 297 WP_008357439.1 septation regulator SpoVG -
  CSE15_RS00325 (CSE15_00325) glmU 58730..60100 (+) 1371 WP_099496225.1 bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU -
  CSE15_RS00330 (CSE15_00330) - 60123..61076 (+) 954 WP_003217907.1 ribose-phosphate diphosphokinase -
  CSE15_RS00335 (CSE15_00335) - 61215..61841 (+) 627 WP_008341853.1 50S ribosomal protein L25/general stress protein Ctc -
  CSE15_RS00340 (CSE15_00340) pth 61982..62548 (+) 567 WP_024719358.1 aminoacyl-tRNA hydrolase -
  CSE15_RS00345 (CSE15_00345) - 62604..62834 (+) 231 WP_003217967.1 anti-sigma-F factor Fin family protein -
  CSE15_RS00350 (CSE15_00350) mfd 62902..66435 (+) 3534 WP_099496226.1 transcription-repair coupling factor -
  CSE15_RS00355 (CSE15_00355) spoVT 66575..67111 (+) 537 WP_007496196.1 stage V sporulation protein T -
  CSE15_RS00360 (CSE15_00360) - 67316..68920 (+) 1605 WP_099496227.1 polysaccharide biosynthesis protein -
  CSE15_RS00365 (CSE15_00365) mazG 68910..70394 (+) 1485 WP_099496228.1 nucleoside triphosphate pyrophosphohydrolase -
  CSE15_RS00370 (CSE15_00370) - 70391..70651 (+) 261 WP_099496229.1 RNA-binding S4 domain-containing protein -
  CSE15_RS00375 (CSE15_00375) yabP 70726..71034 (+) 309 WP_007496190.1 sporulation protein YabP -
  CSE15_RS00380 (CSE15_00380) yabQ 71031..71669 (+) 639 WP_099496230.1 spore cortex biosynthesis protein YabQ -
  CSE15_RS00385 (CSE15_00385) - 71688..72062 (+) 375 WP_007496186.1 FtsB family cell division protein -
  CSE15_RS00390 (CSE15_00390) - 72145..72543 (+) 399 WP_003217901.1 S1 domain-containing RNA-binding protein -
  CSE15_RS00405 (CSE15_00405) spoIIE 73096..75579 (+) 2484 WP_099496231.1 stage II sporulation protein E -
  CSE15_RS00410 (CSE15_00410) - 75656..76390 (+) 735 WP_008341829.1 vWA domain-containing protein -
  CSE15_RS00415 (CSE15_00415) - 76374..77383 (+) 1010 Protein_67 protein kinase domain-containing protein -
  CSE15_RS00420 (CSE15_00420) tilS 77480..78902 (+) 1423 Protein_68 tRNA lysidine(34) synthetase TilS -
  CSE15_RS00425 (CSE15_00425) hpt 78899..79438 (+) 540 WP_007496175.1 hypoxanthine phosphoribosyltransferase -
  CSE15_RS00430 (CSE15_00430) ftsH 79534..81438 (+) 1905 WP_007496173.1 ATP-dependent zinc metalloprotease FtsH -

Sequence


Protein


Download         Length: 96 a.a.        Molecular weight: 10853.65 Da        Isoelectric Point: 7.9655

>NTDB_id=252944 CSE15_RS00255 WP_087975202.1 47030..47320(-) (abrB) [Bacillus altitudinis strain P-10]
MKMKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIILKKYKPNMTCQVTGEVSDDNLKLANGKLVLSREG
AEQIINEIQNQLQSQK

Nucleotide


Download         Length: 291 bp        

>NTDB_id=252944 CSE15_RS00255 WP_087975202.1 47030..47320(-) (abrB) [Bacillus altitudinis strain P-10]
ATGAAGATGAAATCTACAGGTATTGTACGTAAAGTTGACGAATTAGGACGCGTGGTGATTCCAATCGAGCTTCGCCGTAC
GTTAGGAATCGCAGAAAAAGACGCTTTGGAAATTTATGTTGATGATGAAAAAATTATCCTAAAAAAATATAAACCAAACA
TGACTTGCCAAGTAACAGGTGAAGTATCAGACGATAACCTTAAACTTGCTAATGGTAAATTAGTTCTTAGCCGTGAAGGT
GCAGAGCAAATCATTAACGAAATCCAAAACCAACTTCAATCACAAAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  abrB Bacillus subtilis subsp. subtilis str. 168

93.75

100

0.938


Multiple sequence alignment