Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   CEP77_RS05305 Genome accession   NZ_CP028325
Coordinates   1087263..1087376 (+) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   Q9ZEL1
Organism   Helicobacter pylori strain FDAARGOS_298     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1082263..1092376
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CEP77_RS05280 (CEP77_05275) - 1082316..1084541 (+) 2226 WP_108169554.1 ATP-dependent Clp protease ATP-binding subunit -
  CEP77_RS05285 (CEP77_05280) panD 1084531..1084884 (+) 354 WP_000142226.1 aspartate 1-decarboxylase -
  CEP77_RS05290 (CEP77_05285) - 1084887..1085189 (+) 303 WP_000347928.1 YbaB/EbfC family nucleoid-associated protein -
  CEP77_RS05295 (CEP77_05290) - 1085189..1086184 (+) 996 WP_108169555.1 PDZ domain-containing protein -
  CEP77_RS05300 (CEP77_05295) comB6 1086192..1087247 (+) 1056 WP_108169556.1 P-type conjugative transfer protein TrbL Machinery gene
  CEP77_RS05305 (CEP77_05300) comB7 1087263..1087376 (+) 114 WP_001217873.1 hypothetical protein Machinery gene
  CEP77_RS05310 (CEP77_05305) comB8 1087373..1088110 (+) 738 WP_000660523.1 virB8 family protein Machinery gene
  CEP77_RS05315 (CEP77_05310) comB9 1088110..1089090 (+) 981 WP_108169557.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  CEP77_RS05320 (CEP77_05315) comB10 1089083..1090219 (+) 1137 WP_108169558.1 DNA type IV secretion system protein ComB10 Machinery gene
  CEP77_RS05325 (CEP77_05320) - 1090290..1091702 (+) 1413 WP_108169559.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=240711 CEP77_RS05305 WP_001217873.1 1087263..1087376(+) (comB7) [Helicobacter pylori strain FDAARGOS_298]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=240711 CEP77_RS05305 WP_001217873.1 1087263..1087376(+) (comB7) [Helicobacter pylori strain FDAARGOS_298]
ATGAGAATTTTTTTTGTTATTATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q9ZEL1

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1


Multiple sequence alignment