Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   C7M26_RS01335 Genome accession   NZ_CP028212
Coordinates   216147..216530 (+) Length   127 a.a.
NCBI ID   WP_032722118.1    Uniprot ID   -
Organism   Bacillus subtilis strain SRCM102748     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 211147..221530
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C7M26_RS01300 (C7M26_00251) corA 211600..212553 (+) 954 WP_004399136.1 magnesium transporter CorA -
  C7M26_RS01305 (C7M26_00252) - 212555..212752 (+) 198 WP_014480259.1 CBS domain-containing protein -
  C7M26_RS01310 (C7M26_00254) comGA 212965..214035 (+) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  C7M26_RS01315 (C7M26_00255) comGB 214022..215059 (+) 1038 WP_029317912.1 comG operon protein ComGB Machinery gene
  C7M26_RS01320 (C7M26_00256) comGC 215073..215369 (+) 297 WP_029726719.1 comG operon protein ComGC Machinery gene
  C7M26_RS01325 (C7M26_00257) comGD 215359..215790 (+) 432 WP_029726720.1 comG operon protein ComGD Machinery gene
  C7M26_RS01330 (C7M26_00258) comGE 215774..216121 (+) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  C7M26_RS01335 comGF 216147..216530 (+) 384 WP_032722118.1 ComG operon protein ComGF Machinery gene
  C7M26_RS01340 (C7M26_00259) comGG 216531..216905 (+) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  C7M26_RS01345 (C7M26_00260) spoIITA 216977..217156 (+) 180 WP_029726723.1 YqzE family protein -
  C7M26_RS01350 (C7M26_00261) yqzG 217198..217524 (-) 327 WP_003246051.1 YqzG/YhdC family protein -
  C7M26_RS01355 (C7M26_00262) tapA 217796..218557 (+) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  C7M26_RS01360 (C7M26_00263) sipW 218541..219113 (+) 573 WP_072692741.1 signal peptidase I SipW -
  C7M26_RS01365 (C7M26_00264) tasA 219177..219962 (+) 786 WP_014664586.1 biofilm matrix protein TasA -
  C7M26_RS01370 (C7M26_00265) sinR 220055..220390 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  C7M26_RS01375 (C7M26_00266) sinI 220424..220597 (-) 174 WP_003230187.1 anti-repressor SinI Regulator

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14375.50 Da        Isoelectric Point: 5.8940

>NTDB_id=239847 C7M26_RS01335 WP_032722118.1 216147..216530(+) (comGF) [Bacillus subtilis strain SRCM102748]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHITAMKADFENCVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=239847 C7M26_RS01335 WP_032722118.1 216147..216530(+) (comGF) [Bacillus subtilis strain SRCM102748]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGGCAGGACATCCGTTTCGAAATTTATCATTCAATGATAAGAAAAAGAGTGGATGGT
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATTTTGAAAATTGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

97.638

100

0.976