Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   C9I27_RS00680 Genome accession   NZ_CP028148
Coordinates   104209..104493 (+) Length   94 a.a.
NCBI ID   WP_002987779.1    Uniprot ID   A0A0H2USY2
Organism   Streptococcus pyogenes strain TJ11-001     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 99209..109493
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C9I27_RS00655 - 101155..101520 (+) 366 WP_002986560.1 DUF1033 family protein -
  C9I27_RS00660 comGA 101613..102551 (+) 939 WP_002987773.1 competence type IV pilus ATPase ComGA Machinery gene
  C9I27_RS00665 comGB 102487..103521 (+) 1035 WP_223845212.1 competence type IV pilus assembly protein ComGB Machinery gene
  C9I27_RS00670 comGC 103523..103849 (+) 327 WP_002986552.1 competence type IV pilus major pilin ComGC Machinery gene
  C9I27_RS00675 comGD 103824..104252 (+) 429 WP_002986548.1 competence type IV pilus minor pilin ComGD Machinery gene
  C9I27_RS00680 comGE 104209..104493 (+) 285 WP_002987779.1 competence type IV pilus minor pilin ComGE Machinery gene
  C9I27_RS00685 comGF 104486..104920 (+) 435 WP_002987783.1 competence type IV pilus minor pilin ComGF Machinery gene
  C9I27_RS00690 comGG 104904..105230 (+) 327 WP_002987787.1 competence type IV pilus minor pilin ComGG -
  C9I27_RS00695 comGH 105328..106281 (+) 954 WP_002987790.1 class I SAM-dependent methyltransferase Machinery gene
  C9I27_RS00700 - 106340..107536 (+) 1197 WP_002987791.1 acetate kinase -
  C9I27_RS00705 - 107723..108031 (+) 309 WP_002987795.1 hypothetical protein -
  C9I27_RS00710 proC 108114..108884 (-) 771 WP_002986527.1 pyrroline-5-carboxylate reductase -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10672.62 Da        Isoelectric Point: 8.9043

>NTDB_id=238484 C9I27_RS00680 WP_002987779.1 104209..104493(+) (comGE) [Streptococcus pyogenes strain TJ11-001]
MGIIKKQVKAYIALESMIATGILFSIVILVLSSLQQSQAALTYYRKQQEKLNLALMAVQTRTKEMTLNGCHITILRTDRY
ISIHDDEGEVMKIE

Nucleotide


Download         Length: 285 bp        

>NTDB_id=238484 C9I27_RS00680 WP_002987779.1 104209..104493(+) (comGE) [Streptococcus pyogenes strain TJ11-001]
GTGGGAATTATCAAAAAACAAGTCAAAGCTTACATAGCCCTTGAAAGTATGATTGCAACAGGCATCCTCTTTAGTATTGT
CATTCTCGTCTTAAGCAGTTTACAGCAGAGTCAGGCTGCTCTAACGTACTATCGAAAGCAGCAAGAAAAGCTTAATCTAG
CCTTGATGGCAGTACAAACTAGAACTAAAGAGATGACATTGAATGGTTGTCATATTACTATTTTACGTACGGATAGATAC
ATTAGTATTCACGATGACGAAGGAGAAGTGATGAAGATTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A0H2USY2

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Lactococcus lactis subsp. cremoris KW2

38.298

100

0.383