Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   BSSX_RS15985 Genome accession   NZ_CP022287
Coordinates   3078443..3078583 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain SX01705     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3073443..3083583
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BSSX_RS15960 (BSSX_3294) yuxO 3073786..3074166 (-) 381 WP_015483631.1 hotdog fold thioesterase -
  BSSX_RS15965 (BSSX_3295) comA 3074184..3074828 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  BSSX_RS15970 comP 3074909..3077209 (-) 2301 WP_046340263.1 histidine kinase Regulator
  BSSX_RS15975 (BSSX_3297) comX 3077221..3077385 (-) 165 WP_015384519.1 competence pheromone ComX -
  BSSX_RS15980 (BSSX_3298) - 3077398..3078258 (-) 861 WP_089030041.1 polyprenyl synthetase family protein -
  BSSX_RS15985 (BSSX_3299) degQ 3078443..3078583 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  BSSX_RS22125 - 3078805..3078867 (+) 63 Protein_3097 hypothetical protein -
  BSSX_RS15990 (BSSX_3300) - 3079045..3079413 (+) 369 WP_015483634.1 hypothetical protein -
  BSSX_RS15995 (BSSX_3301) pdeH 3079389..3080618 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  BSSX_RS16000 (BSSX_3302) pncB 3080755..3082227 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  BSSX_RS16005 (BSSX_3303) pncA 3082243..3082794 (-) 552 WP_014477836.1 isochorismatase family cysteine hydrolase -
  BSSX_RS16010 (BSSX_3304) yueI 3082891..3083289 (-) 399 WP_015483635.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=238017 BSSX_RS15985 WP_003220708.1 3078443..3078583(-) (degQ) [Bacillus subtilis strain SX01705]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=238017 BSSX_RS15985 WP_003220708.1 3078443..3078583(-) (degQ) [Bacillus subtilis strain SX01705]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment