Detailed information    

insolico Bioinformatically predicted

Overview

Name   codY   Type   Regulator
Locus tag   BT9727_RS18745 Genome accession   NC_005957
Coordinates   3664800..3665579 (-) Length   259 a.a.
NCBI ID   WP_000421288.1    Uniprot ID   Q81WK7
Organism   [Bacillus thuringiensis] serovar konkukian str. 97-27     
Function   repression of comK (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 3630476..3704402 3664800..3665579 within 0


Gene organization within MGE regions


Location: 3630476..3704402
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BT9727_RS18595 (BT9727_3538) - 3630819..3632489 (-) 1671 WP_000823087.1 ribonuclease J -
  BT9727_RS18600 (BT9727_3540) dapA 3633256..3634134 (-) 879 WP_000564761.1 4-hydroxy-tetrahydrodipicolinate synthase -
  BT9727_RS18605 (BT9727_3541) dapG 3634146..3635378 (-) 1233 WP_000692470.1 aspartate kinase -
  BT9727_RS18610 (BT9727_3542) asd 3635402..3636448 (-) 1047 WP_000414842.1 aspartate-semialdehyde dehydrogenase -
  BT9727_RS18615 (BT9727_3543) dpaB 3636599..3637198 (-) 600 WP_001049484.1 dipicolinate synthase subunit B -
  BT9727_RS18620 (BT9727_3544) dpaA 3637195..3638097 (-) 903 WP_000954724.1 dipicolinic acid synthetase subunit A -
  BT9727_RS18625 (BT9727_3545) - 3638372..3638623 (-) 252 WP_001239752.1 YlmC/YmxH family sporulation protein -
  BT9727_RS18630 (BT9727_3546) - 3638750..3639991 (-) 1242 WP_000592994.1 M16 family metallopeptidase -
  BT9727_RS18635 (BT9727_3547) - 3640078..3640977 (-) 900 WP_000647537.1 polysaccharide deacetylase family protein -
  BT9727_RS18640 (BT9727_3548) pnp 3641129..3643267 (-) 2139 WP_000076750.1 polyribonucleotide nucleotidyltransferase -
  BT9727_RS18645 (BT9727_3549) rpsO 3643428..3643697 (-) 270 WP_001229392.1 30S ribosomal protein S15 -
  BT9727_RS18650 (BT9727_3550) ribF 3643798..3644769 (-) 972 WP_000766711.1 bifunctional riboflavin kinase/FAD synthetase -
  BT9727_RS18655 (BT9727_3551) truB 3644813..3645736 (-) 924 WP_000399346.1 tRNA pseudouridine(55) synthase TruB -
  BT9727_RS18660 (BT9727_3552) rbfA 3645823..3646179 (-) 357 WP_000776442.1 30S ribosome-binding factor RbfA -
  BT9727_RS18665 (BT9727_3553) - 3646195..3646476 (-) 282 WP_000582364.1 DUF503 domain-containing protein -
  BT9727_RS18670 (BT9727_3554) infB 3646473..3648533 (-) 2061 WP_000036341.1 translation initiation factor IF-2 -
  BT9727_RS18675 (BT9727_3555) - 3648538..3648849 (-) 312 WP_001286523.1 YlxQ family RNA-binding protein -
  BT9727_RS18680 (BT9727_3556) rnpM 3648850..3649122 (-) 273 WP_000071128.1 RNase P modulator RnpM -
  BT9727_RS18685 (BT9727_3557) nusA 3649134..3650240 (-) 1107 WP_000102609.1 transcription termination factor NusA -
  BT9727_RS18690 (BT9727_3558) rimP 3650258..3650728 (-) 471 WP_000359097.1 ribosome maturation factor RimP -
  BT9727_RS18695 (BT9727_3559) - 3651061..3655362 (-) 4302 WP_000059989.1 PolC-type DNA polymerase III -
  BT9727_RS18700 (BT9727_3560) - 3655487..3657187 (-) 1701 WP_000814310.1 proline--tRNA ligase -
  BT9727_RS18705 (BT9727_3561) rseP 3657297..3658553 (-) 1257 WP_001090229.1 RIP metalloprotease RseP -
  BT9727_RS18710 (BT9727_3562) dxr 3658570..3659712 (-) 1143 WP_000790356.1 1-deoxy-D-xylulose-5-phosphate reductoisomerase -
  BT9727_RS18715 (BT9727_3563) cdsA 3659736..3660527 (-) 792 WP_000813583.1 phosphatidate cytidylyltransferase -
  BT9727_RS18720 (BT9727_3564) uppS 3660545..3661321 (-) 777 WP_000971301.1 isoprenyl transferase -
  BT9727_RS18725 (BT9727_3565) frr 3661407..3661964 (-) 558 WP_000531503.1 ribosome recycling factor -
  BT9727_RS18730 (BT9727_3566) pyrH 3661967..3662689 (-) 723 WP_000042663.1 UMP kinase -
  BT9727_RS18735 (BT9727_3567) tsf 3662756..3663643 (-) 888 WP_001018581.1 translation elongation factor Ts -
  BT9727_RS18740 (BT9727_3568) rpsB 3663747..3664448 (-) 702 WP_000111483.1 30S ribosomal protein S2 -
  BT9727_RS18745 (BT9727_3569) codY 3664800..3665579 (-) 780 WP_000421288.1 GTP-sensing pleiotropic transcriptional regulator CodY Regulator
  BT9727_RS18750 (BT9727_3570) hslU 3665657..3667048 (-) 1392 WP_000550088.1 ATP-dependent protease ATPase subunit HslU -
  BT9727_RS18755 (BT9727_3571) hslV 3667071..3667613 (-) 543 WP_000526272.1 ATP-dependent protease proteolytic subunit HslV -
  BT9727_RS18760 (BT9727_3572) xerC 3667656..3668555 (-) 900 WP_001101227.1 tyrosine recombinase XerC -
  BT9727_RS18765 (BT9727_3573) trmFO 3668621..3669925 (-) 1305 WP_001991958.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  BT9727_RS18770 (BT9727_3574) topA 3669976..3672054 (-) 2079 WP_001286968.1 type I DNA topoisomerase -
  BT9727_RS18775 (BT9727_3575) dprA 3672199..3673068 (-) 870 WP_000818032.1 DNA-processing protein DprA -
  BT9727_RS18780 (BT9727_3576) sucD 3673156..3674058 (-) 903 WP_000115178.1 succinate--CoA ligase subunit alpha -
  BT9727_RS18785 (BT9727_3577) sucC 3674078..3675238 (-) 1161 WP_001020785.1 ADP-forming succinate--CoA ligase subunit beta -
  BT9727_RS18790 (BT9727_3578) rnhB 3675432..3676205 (-) 774 WP_001174721.1 ribonuclease HII -
  BT9727_RS18795 (BT9727_3579) ylqF 3676257..3677147 (-) 891 WP_000236706.1 ribosome biogenesis GTPase YlqF -
  BT9727_RS18800 (BT9727_3580) lepB 3677168..3677719 (-) 552 WP_000711857.1 signal peptidase I -
  BT9727_RS18805 (BT9727_3581) rplS 3677821..3678165 (-) 345 WP_001186516.1 50S ribosomal protein L19 -
  BT9727_RS18810 (BT9727_3582) trmD 3678312..3679046 (-) 735 WP_000686892.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  BT9727_RS18815 (BT9727_3583) rimM 3679046..3679561 (-) 516 WP_000170268.1 ribosome maturation factor RimM -
  BT9727_RS18820 (BT9727_3584) - 3679682..3679909 (-) 228 WP_000737398.1 KH domain-containing protein -
  BT9727_RS18825 (BT9727_3585) rpsP 3679924..3680196 (-) 273 WP_000268750.1 30S ribosomal protein S16 -
  BT9727_RS18830 (BT9727_3586) ffh 3680297..3681646 (-) 1350 WP_000863461.1 signal recognition particle protein -
  BT9727_RS18835 (BT9727_3587) - 3681659..3681991 (-) 333 WP_000891062.1 putative DNA-binding protein -
  BT9727_RS18840 (BT9727_3588) ftsY 3682125..3683114 (-) 990 WP_000007650.1 signal recognition particle-docking protein FtsY -
  BT9727_RS18845 (BT9727_3589) smc 3683130..3686699 (-) 3570 WP_000478987.1 chromosome segregation protein SMC -
  BT9727_RS18850 (BT9727_3590) rncS 3686846..3687583 (-) 738 WP_001146873.1 ribonuclease III -
  BT9727_RS18855 (BT9727_3591) acpP 3687642..3687875 (-) 234 WP_000786062.1 acyl carrier protein -
  BT9727_RS18860 (BT9727_3592) fabG 3687945..3688685 (-) 741 WP_000911782.1 3-oxoacyl-[acyl-carrier-protein] reductase -
  BT9727_RS18865 (BT9727_3593) fabD 3688685..3689629 (-) 945 WP_000516948.1 ACP S-malonyltransferase -
  BT9727_RS18870 (BT9727_3594) plsX 3689644..3690636 (-) 993 WP_000684110.1 phosphate acyltransferase PlsX -
  BT9727_RS18875 (BT9727_3595) fapR 3690633..3691226 (-) 594 WP_000747352.1 transcription factor FapR -
  BT9727_RS18880 (BT9727_3596) recG 3691315..3693363 (-) 2049 WP_001006884.1 ATP-dependent DNA helicase RecG -
  BT9727_RS18885 (BT9727_3597) - 3693653..3695329 (-) 1677 WP_000027136.1 DAK2 domain-containing protein -
  BT9727_RS18890 (BT9727_3598) - 3695352..3695714 (-) 363 WP_000021109.1 Asp23/Gls24 family envelope stress response protein -
  BT9727_RS18895 (BT9727_3599) rpmB 3696093..3696281 (+) 189 WP_000124776.1 50S ribosomal protein L28 -
  BT9727_RS18900 spoVM 3696355..3696435 (-) 81 WP_001213599.1 stage V sporulation protein SpoVM -
  BT9727_RS18905 (BT9727_3600) - 3696502..3697182 (-) 681 WP_042515256.1 thiamine diphosphokinase -
  BT9727_RS18910 (BT9727_3601) rpe 3697281..3697925 (-) 645 WP_000589966.1 ribulose-phosphate 3-epimerase -
  BT9727_RS18915 (BT9727_3602) rsgA 3697928..3698809 (-) 882 WP_001113935.1 ribosome small subunit-dependent GTPase A -
  BT9727_RS18920 (BT9727_3603) prkC 3699078..3701051 (-) 1974 WP_000904759.1 serine/threonine protein kinase PrkC -
  BT9727_RS18925 (BT9727_3604) - 3701060..3701812 (-) 753 WP_000648699.1 Stp1/IreP family PP2C-type Ser/Thr phosphatase -
  BT9727_RS18930 (BT9727_3605) rlmN 3701817..3702905 (-) 1089 WP_000450546.1 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN -
  BT9727_RS18935 (BT9727_3606) rsmB 3702910..3704244 (-) 1335 WP_001249680.1 16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB -

Sequence

Protein


Download         Length: 259 a.a.        Molecular weight: 28774.05 Da        Isoelectric Point: 4.7947

>NTDB_id=23371 BT9727_RS18745 WP_000421288.1 3664800..3665579(-) (codY) [[Bacillus thuringiensis] serovar konkukian str. 97-27]
MELLAKTRKLNALLQSAAGKPVNFREMSDTMCEVIEANVFVVSRRGKLLGYAIHQQIENERMKQMLAERQFPEEYTQSLF
NITETSSNLDVNSAYTAFPVENKELFGQGLTTIVPIVGGGERLGTLVLARLGQEFLDDDLILAEYSSTVVGMEILREKAE
EIEEEARSKAVVQMAISSLSYSELEAIEHIFEELNGTEGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGMKGT
YIKVLNDKFLHELAKLKTN

Nucleotide


Download         Length: 780 bp        

>NTDB_id=23371 BT9727_RS18745 WP_000421288.1 3664800..3665579(-) (codY) [[Bacillus thuringiensis] serovar konkukian str. 97-27]
ATGGAATTATTAGCAAAAACAAGAAAATTAAATGCGTTATTACAGAGCGCAGCAGGAAAGCCTGTAAACTTTAGAGAAAT
GTCTGACACAATGTGTGAAGTAATCGAAGCGAACGTATTCGTAGTAAGTCGTCGTGGTAAATTACTAGGTTATGCAATTC
ACCAACAAATCGAGAATGAGCGTATGAAACAAATGCTTGCAGAACGTCAATTCCCAGAAGAGTATACACAAAGCTTATTC
AACATTACAGAAACATCTTCAAACTTAGATGTAAACAGTGCTTACACAGCATTCCCAGTAGAAAATAAAGAATTATTTGG
TCAAGGTTTAACTACAATCGTACCGATCGTTGGTGGCGGTGAGCGTCTAGGTACATTAGTTTTAGCTCGTCTTGGTCAAG
AGTTCTTAGATGATGATTTAATTCTTGCTGAGTACAGCTCAACTGTTGTAGGTATGGAAATTTTACGTGAAAAAGCAGAA
GAAATCGAAGAAGAAGCACGTAGCAAAGCTGTTGTTCAAATGGCGATCAGCTCATTATCTTACAGTGAATTAGAAGCAAT
CGAGCACATCTTCGAAGAATTAAACGGAACAGAAGGTTTACTTGTTGCAAGTAAAATTGCTGACCGCGTAGGAATCACTC
GTTCGGTAATCGTAAATGCACTTCGTAAATTAGAAAGTGCTGGTGTAATTGAGTCGCGTTCTTTAGGTATGAAAGGAACA
TACATTAAAGTATTAAACGACAAATTCTTACATGAACTTGCTAAATTAAAAACAAACTAA

Domains

Predicted by InterproScan.

CodY GAF-like domain (CodY)

(2-178)

CodY helix-turn-helix domain (HTH_CodY)

(198-255)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB Q81WK7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  codY Bacillus subtilis subsp. subtilis str. 168

81.081

100

0.811
  codY Lactococcus lactis subsp. lactis strain DGCC12653

46.667

98.456

0.459

Multiple sequence alignment