Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   S100141_RS10135 Genome accession   NZ_CP021669
Coordinates   1884178..1884354 (+) Length   58 a.a.
NCBI ID   WP_003183444.1    Uniprot ID   -
Organism   Bacillus licheniformis strain SRCM100141     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 1879178..1889354
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  S100141_RS10120 (S100141_02046) gcvT 1879820..1880914 (-) 1095 WP_003183436.1 glycine cleavage system aminomethyltransferase GcvT -
  S100141_RS10125 (S100141_02047) - 1881507..1883186 (+) 1680 WP_003183439.1 DEAD/DEAH box helicase -
  S100141_RS10130 (S100141_02048) - 1883193..1883987 (+) 795 WP_003183441.1 YqhG family protein -
  S100141_RS10135 (S100141_02049) sinI 1884178..1884354 (+) 177 WP_003183444.1 anti-repressor SinI Regulator
  S100141_RS10140 (S100141_02050) sinR 1884388..1884723 (+) 336 WP_006637528.1 transcriptional regulator SinR Regulator
  S100141_RS10145 (S100141_02051) tasA 1884828..1885622 (-) 795 WP_003183447.1 biofilm matrix protein TasA -
  S100141_RS10150 (S100141_02052) sipW 1885696..1886280 (-) 585 WP_003183449.1 signal peptidase I SipW -
  S100141_RS10155 (S100141_02053) tapA 1886277..1887005 (-) 729 WP_003183451.1 amyloid fiber anchoring/assembly protein TapA -
  S100141_RS10160 (S100141_02054) - 1887282..1887602 (+) 321 WP_003183454.1 YqzG/YhdC family protein -
  S100141_RS10165 (S100141_02055) - 1887626..1887808 (-) 183 WP_003183456.1 YqzE family protein -
  S100141_RS10170 (S100141_02056) comGG 1887897..1888262 (-) 366 WP_003183459.1 competence type IV pilus minor pilin ComGG -
  S100141_RS10175 (S100141_02057) comGF 1888275..1888763 (-) 489 WP_011201694.1 competence type IV pilus minor pilin ComGF -
  S100141_RS10180 comGE 1888672..1889019 (-) 348 WP_009327907.1 competence type IV pilus minor pilin ComGE -

Sequence

Protein


Download         Length: 58 a.a.        Molecular weight: 6724.47 Da        Isoelectric Point: 4.7616

>NTDB_id=232360 S100141_RS10135 WP_003183444.1 1884178..1884354(+) (sinI) [Bacillus licheniformis strain SRCM100141]
MNKDKNEKEELDEEWTDLIKHALEQGISPEEIRIFLNLGKKSSNPSTSIERSHSINPF

Nucleotide


Download         Length: 177 bp        

>NTDB_id=232360 S100141_RS10135 WP_003183444.1 1884178..1884354(+) (sinI) [Bacillus licheniformis strain SRCM100141]
ATGAATAAAGATAAAAATGAGAAAGAAGAATTGGATGAGGAGTGGACAGACTTGATTAAACACGCTCTTGAACAAGGCAT
TAGTCCAGAGGAAATACGTATTTTTCTCAATTTGGGAAAGAAGTCTTCAAATCCTTCCACATCAATTGAAAGAAGTCATT
CAATAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

51.724

100

0.517

Multiple sequence alignment