Detailed information
Bioinformatically predicted
Overview
| Name | cipB | Type | Regulator |
| Locus tag | SP_RS02665 | Genome accession | NC_003028 |
| Coordinates | 515809..515958 (+) | Length | 49 a.a. |
| NCBI ID | WP_001818346.1 | Uniprot ID | Q9FBH1 |
| Organism | Streptococcus pneumoniae TIGR4 | ||
| Function | indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation |
||
Genomic Context
Location: 510809..520958
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SP_RS13735 | comA/nlmT | 510850..511437 (-) | 588 | WP_000205166.1 | cysteine peptidase family C39 domain-containing protein | Regulator |
| SP_RS02610 (SP_0531) | blpI | 511719..511916 (+) | 198 | WP_001093259.1 | bacteriocin-like peptide BlpI | - |
| SP_RS02615 (SP_0532) | blpJ | 512383..512652 (+) | 270 | WP_001093248.1 | bacteriocin-like peptide BlpJ | - |
| SP_RS02620 (SP_0533) | blpU | 512721..512951 (+) | 231 | WP_000379967.1 | bacteriocin-like peptide BlpU | - |
| SP_RS02625 | - | 512954..513073 (+) | 120 | WP_000346296.1 | PncF family bacteriocin immunity protein | - |
| SP_RS13000 (SP_0535) | - | 513370..513534 (+) | 165 | WP_000727118.1 | hypothetical protein | - |
| SP_RS02640 (SP_0536) | - | 513531..513935 (+) | 405 | WP_000846943.1 | hypothetical protein | - |
| SP_RS11830 | - | 514138..514942 (+) | 805 | WP_100214365.1 | IS5 family transposase | - |
| SP_RS02655 (SP_0539) | blpM | 515092..515346 (+) | 255 | WP_000379879.1 | two-peptide bacteriocin subunit BlpM | - |
| SP_RS02660 (SP_0540) | blpN | 515362..515565 (+) | 204 | WP_001099492.1 | two-peptide bacteriocin subunit BlpN | - |
| SP_RS02665 (SP_0541) | cipB | 515809..515958 (+) | 150 | WP_001818346.1 | bacteriocin-like peptide BlpO | Regulator |
| SP_RS02670 | - | 516062..516181 (+) | 120 | WP_000346296.1 | PncF family bacteriocin immunity protein | - |
| SP_RS02680 (SP_0544) | - | 516967..517350 (+) | 384 | WP_000877381.1 | hypothetical protein | - |
| SP_RS02685 (SP_0545) | - | 517402..518091 (+) | 690 | WP_000760538.1 | CPBP family intramembrane glutamic endopeptidase | - |
| SP_RS02690 (SP_0546) | blpZ | 518133..518366 (+) | 234 | WP_000276498.1 | immunity protein BlpZ | - |
| SP_RS02695 (SP_0547) | - | 518517..519128 (+) | 612 | WP_000394045.1 | CPBP family intramembrane glutamic endopeptidase | - |
| SP_RS02700 (SP_0549) | ccrZ | 519289..520083 (+) | 795 | WP_000363002.1 | cell cycle regulator CcrZ | - |
| SP_RS02705 (SP_0550) | trmB | 520080..520715 (+) | 636 | WP_001266083.1 | tRNA (guanosine(46)-N7)-methyltransferase TrmB | - |
Sequence
Protein
Download Length: 49 a.a. Molecular weight: 5134.91 Da Isoelectric Point: 3.9133
>NTDB_id=22206 SP_RS02665 WP_001818346.1 515809..515958(+) (cipB) [Streptococcus pneumoniae TIGR4]
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
Nucleotide
Download Length: 150 bp
>NTDB_id=22206 SP_RS02665 WP_001818346.1 515809..515958(+) (cipB) [Streptococcus pneumoniae TIGR4]
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| cipB | Streptococcus mutans UA159 |
51.02 |
100 |
0.51 |