Detailed information    

insolico Bioinformatically predicted

Overview


Name   pilK   Type   Machinery gene
Locus tag   BZG34_RS05490 Genome accession   NZ_CP019467
Coordinates   929915..930523 (-) Length   202 a.a.
NCBI ID   WP_047921847.1    Uniprot ID   A0AA44ZGE4
Organism   Neisseria gonorrhoeae strain RIVM0640     
Function   type IV pilus (predicted from homology)   
DNA binding and uptake

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 878625..939819 929915..930523 within 0


Gene organization within MGE regions


Location: 878625..939819
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BZG34_RS05130 (BZG34_05095) purM 880206..881240 (-) 1035 WP_003691398.1 phosphoribosylformylglycinamidine cyclo-ligase -
  BZG34_RS05135 (BZG34_05100) - 881481..881669 (+) 189 WP_003689039.1 hypothetical protein -
  BZG34_RS05140 (BZG34_05105) - 881929..882918 (+) 990 WP_003689040.1 site-specific integrase -
  BZG34_RS05150 (BZG34_05115) - 883260..883739 (+) 480 WP_002241413.1 DUF4760 domain-containing protein -
  BZG34_RS05155 (BZG34_05120) - 883799..886843 (-) 3045 WP_050155384.1 tape measure protein -
  BZG34_RS05160 (BZG34_05125) - 886873..887022 (-) 150 WP_003691402.1 hypothetical protein -
  BZG34_RS13420 - 887334..887507 (-) 174 WP_017146757.1 hypothetical protein -
  BZG34_RS05165 (BZG34_05130) - 887491..887832 (-) 342 WP_003700102.1 hypothetical protein -
  BZG34_RS13425 (BZG34_05135) - 887816..887974 (-) 159 WP_003691816.1 hypothetical protein -
  BZG34_RS05170 (BZG34_05140) - 887974..888513 (-) 540 WP_050153719.1 TIGR02594 family protein -
  BZG34_RS14525 - 888555..888680 (-) 126 WP_255294325.1 hypothetical protein -
  BZG34_RS05180 (BZG34_05150) - 888720..888956 (+) 237 WP_003689049.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
  BZG34_RS05185 (BZG34_05155) - 888956..889303 (+) 348 WP_003689051.1 type II toxin-antitoxin system PemK/MazF family toxin -
  BZG34_RS05190 (BZG34_05160) - 889669..890001 (-) 333 WP_003691408.1 hypothetical protein -
  BZG34_RS05195 (BZG34_05165) - 890002..890472 (-) 471 WP_003689057.1 hypothetical protein -
  BZG34_RS05200 (BZG34_05170) - 890543..890848 (-) 306 WP_003689058.1 hypothetical protein -
  BZG34_RS05205 (BZG34_05175) - 890960..895105 (-) 4146 WP_050155385.1 phage tail protein -
  BZG34_RS05210 (BZG34_05180) - 895345..895623 (+) 279 WP_003689062.1 XRE family transcriptional regulator -
  BZG34_RS05215 (BZG34_05185) - 895651..896082 (-) 432 WP_003689064.1 NlpC/P60 family protein -
  BZG34_RS05220 (BZG34_05190) - 896084..896938 (-) 855 WP_003698614.1 DUF2163 domain-containing protein -
  BZG34_RS05225 (BZG34_05195) - 896935..897534 (-) 600 WP_003692874.1 DUF2460 domain-containing protein -
  BZG34_RS05230 (BZG34_05200) - 897534..897800 (-) 267 WP_003689070.1 hypothetical protein -
  BZG34_RS05235 (BZG34_05205) - 897812..898141 (-) 330 WP_003692871.1 hypothetical protein -
  BZG34_RS05240 (BZG34_05210) - 898202..898975 (-) 774 WP_003691416.1 hypothetical protein -
  BZG34_RS05245 (BZG34_05215) - 899001..899429 (-) 429 WP_003689076.1 hypothetical protein -
  BZG34_RS05250 (BZG34_05220) - 899426..899908 (-) 483 WP_044271038.1 HK97 gp10 family phage protein -
  BZG34_RS05255 (BZG34_05225) - 899908..900438 (-) 531 WP_003689080.1 head-tail connector protein -
  BZG34_RS13760 (BZG34_05230) - 900441..900803 (-) 363 WP_003689082.1 hypothetical protein -
  BZG34_RS05265 (BZG34_05235) - 900810..902309 (-) 1500 WP_047925362.1 hypothetical protein -
  BZG34_RS05270 (BZG34_05240) - 902350..903507 (-) 1158 WP_003691421.1 HK97 family phage prohead protease -
  BZG34_RS05275 (BZG34_05245) - 903575..905722 (-) 2148 WP_003691423.1 phage portal protein -
  BZG34_RS05280 (BZG34_05250) terL 905719..907140 (-) 1422 WP_003697216.1 phage terminase large subunit -
  BZG34_RS05285 (BZG34_05255) - 907202..907651 (-) 450 WP_003689093.1 hypothetical protein -
  BZG34_RS05290 (BZG34_05260) - 907944..908813 (-) 870 WP_047921543.1 BRO family protein -
  BZG34_RS05295 (BZG34_05265) - 909094..909513 (-) 420 WP_229690312.1 type I restriction endonuclease -
  BZG34_RS05300 (BZG34_05270) - 909604..910011 (-) 408 WP_003691430.1 hypothetical protein -
  BZG34_RS14530 - 910133..910261 (+) 129 WP_012503747.1 hypothetical protein -
  BZG34_RS05310 (BZG34_05280) - 910278..910658 (-) 381 WP_017147222.1 RusA family crossover junction endodeoxyribonuclease -
  BZG34_RS14310 - 910649..910930 (-) 282 WP_003689109.1 hypothetical protein -
  BZG34_RS05315 (BZG34_05285) - 910959..911108 (-) 150 WP_003689110.1 hypothetical protein -
  BZG34_RS05320 (BZG34_05290) - 911285..911779 (-) 495 WP_041421248.1 DUF3310 domain-containing protein -
  BZG34_RS05325 (BZG34_05295) - 911818..912081 (-) 264 WP_154235845.1 hypothetical protein -
  BZG34_RS05330 (BZG34_05300) - 912118..913479 (-) 1362 WP_003689132.1 DnaB-like helicase C-terminal domain-containing protein -
  BZG34_RS05335 (BZG34_05305) - 913476..914540 (-) 1065 WP_050154181.1 hypothetical protein -
  BZG34_RS05340 (BZG34_05310) - 914658..914885 (-) 228 WP_003698261.1 helix-turn-helix domain-containing protein -
  BZG34_RS05350 (BZG34_05320) - 915266..915982 (+) 717 WP_003695999.1 helix-turn-helix transcriptional regulator -
  BZG34_RS05355 (BZG34_05325) - 916142..916681 (+) 540 WP_003695998.1 Panacea domain-containing protein -
  BZG34_RS05360 (BZG34_05330) - 916682..917041 (+) 360 WP_003691733.1 hypothetical protein -
  BZG34_RS05365 (BZG34_05335) - 917058..917276 (-) 219 WP_003691731.1 hypothetical protein -
  BZG34_RS05370 (BZG34_05340) - 917760..917960 (+) 201 WP_047920246.1 hypothetical protein -
  BZG34_RS05375 (BZG34_05345) - 917993..918469 (+) 477 WP_002255718.1 hypothetical protein -
  BZG34_RS05380 (BZG34_05350) - 918466..918759 (+) 294 WP_119160497.1 hypothetical protein -
  BZG34_RS05385 (BZG34_05355) - 918901..919233 (+) 333 WP_050155386.1 hypothetical protein -
  BZG34_RS05390 (BZG34_05360) - 919386..919661 (+) 276 WP_050155387.1 NGO1622 family putative holin -
  BZG34_RS05395 (BZG34_05365) - 919658..919819 (+) 162 WP_003693867.1 hypothetical protein -
  BZG34_RS05400 (BZG34_05370) - 919888..920574 (+) 687 WP_042758540.1 phage replication initiation protein, NGO0469 family -
  BZG34_RS05405 (BZG34_05375) - 920714..920896 (+) 183 WP_003691535.1 hypothetical protein -
  BZG34_RS05410 (BZG34_05380) - 920893..921384 (+) 492 WP_047916888.1 siphovirus Gp157 family protein -
  BZG34_RS05415 (BZG34_05385) - 921436..921651 (+) 216 WP_003691538.1 hypothetical protein -
  BZG34_RS14675 - 921762..921995 (+) 234 Protein_946 hypothetical protein -
  BZG34_RS05425 (BZG34_05395) - 922309..922992 (+) 684 WP_003687929.1 DUF2786 domain-containing protein -
  BZG34_RS05430 (BZG34_05400) - 923187..923456 (+) 270 WP_003687928.1 hypothetical protein -
  BZG34_RS05445 (BZG34_05410) - 923812..925012 (-) 1201 Protein_949 tyrosine-type recombinase/integrase -
  BZG34_RS05460 (BZG34_05425) yaaA 925542..926321 (-) 780 WP_003687925.1 peroxide stress protein YaaA -
  BZG34_RS05465 (BZG34_05430) dapC 926477..927664 (-) 1188 WP_003701073.1 succinyldiaminopimelate transaminase -
  BZG34_RS05470 (BZG34_05435) dut 927736..928188 (-) 453 WP_003701071.1 dUTP diphosphatase -
  BZG34_RS05475 (BZG34_05440) - 928354..929065 (+) 712 Protein_953 AzlC family ABC transporter permease -
  BZG34_RS05480 (BZG34_05445) - 929062..929370 (+) 309 WP_003706588.1 AzlD family protein -
  BZG34_RS05485 (BZG34_05450) pilL 929440..929913 (-) 474 WP_012503482.1 PilX family type IV pilin Machinery gene
  BZG34_RS05490 (BZG34_05455) pilK 929915..930523 (-) 609 WP_047921847.1 PilX N-terminal domain-containing pilus assembly protein Machinery gene
  BZG34_RS05495 (BZG34_05460) pilJ 930502..931464 (-) 963 WP_047921846.1 PilW family protein Machinery gene
  BZG34_RS05500 (BZG34_05465) pilI 931461..932075 (-) 615 WP_012503479.1 type IV pilus modification protein PilV Machinery gene
  BZG34_RS05505 (BZG34_05470) pilH 932107..932769 (-) 663 WP_047916986.1 Tfp pilus assembly protein FimT/FimU Machinery gene
  BZG34_RS05510 (BZG34_05475) dnaB 933026..934429 (-) 1404 WP_012503477.1 replicative DNA helicase -
  BZG34_RS05520 (BZG34_05485) - 934593..935174 (+) 582 WP_003690895.1 superoxide dismutase -
  BZG34_RS05530 (BZG34_05495) - 935406..935915 (-) 510 WP_003687909.1 isoprenylcysteine carboxyl methyltransferase family protein -
  BZG34_RS05535 (BZG34_05500) - 936245..936577 (-) 333 WP_003687908.1 hypothetical protein -
  BZG34_RS05540 (BZG34_05505) cysT 936763..937592 (+) 830 Protein_964 sulfate ABC transporter permease subunit CysT -
  BZG34_RS05545 (BZG34_05510) cysW 937781..938602 (+) 822 WP_012503473.1 sulfate ABC transporter permease subunit CysW -
  BZG34_RS13765 - 938598..938705 (+) 108 Protein_966 IS5/IS1182 family transposase -
  BZG34_RS05550 (BZG34_05520) - 938743..939819 (+) 1077 WP_003687905.1 sulfate/molybdate ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 202 a.a.        Molecular weight: 22039.97 Da        Isoelectric Point: 7.5810

>NTDB_id=216010 BZG34_RS05490 WP_047921847.1 929915..930523(-) (pilK) [Neisseria gonorrhoeae strain RIVM0640]
MRKQNALTGIPTSEGQRGFALFIVLMVMIVVAFLVVTAAQSYNTEQRISANESDRKLALSLAEAALREGEFQVLDLEYTA
DSKVTFSENCENGLCTAVNVRTNDANEEAFDNIVVKGKPTVEAVKRSCPAKSGKNSTGLCIDNQGVEYKKGTGNVSKMPR
YIIEYLGVKNGQNVYRVTAKAWGKNANTVVVLQSYVGNNDEQ

Nucleotide


Download         Length: 609 bp        

>NTDB_id=216010 BZG34_RS05490 WP_047921847.1 929915..930523(-) (pilK) [Neisseria gonorrhoeae strain RIVM0640]
ATGCGCAAACAGAACGCTTTGACAGGAATCCCGACTTCTGAGGGACAGAGGGGGTTCGCACTGTTTATCGTGCTGATGGT
GATGATAGTCGTGGCCTTTTTGGTTGTAACTGCCGCCCAGTCCTACAATACCGAACAGAGGATCAGTGCCAACGAATCAG
ACAGGAAATTGGCTTTGTCTTTAGCCGAGGCGGCTTTGAGGGAAGGCGAATTTCAGGTTTTGGATTTGGAATATACTGCG
GATAGTAAGGTTACATTTAGCGAAAACTGTGAAAACGGCCTGTGTACCGCAGTGAATGTACGGACAAATGATGCTAATGA
AGAGGCTTTTGACAATATCGTGGTGAAAGGCAAGCCCACCGTTGAGGCGGTGAAGCGTTCTTGCCCTGCAAAGTCTGGCA
AAAATTCTACCGGCCTGTGCATTGACAATCAGGGAGTGGAATATAAGAAAGGTACGGGAAACGTCAGCAAAATGCCGCGC
TATATTATCGAATATTTAGGCGTGAAGAACGGACAAAATGTTTATCGGGTTACTGCCAAGGCTTGGGGTAAGAATGCCAA
TACCGTGGTCGTCCTTCAATCTTATGTAGGCAATAATGATGAGCAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  pilK Neisseria gonorrhoeae MS11

92.611

100

0.931


Multiple sequence alignment