Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   CG450_RS09105 Genome accession   NZ_CP022477
Coordinates   1736983..1737420 (+) Length   145 a.a.
NCBI ID   WP_009327905.1    Uniprot ID   Q8VQ70
Organism   Bacillus licheniformis strain BL-010     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1731983..1742420
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CG450_RS09070 - 1732515..1732760 (-) 246 WP_003183483.1 DUF2626 domain-containing protein -
  CG450_RS09075 - 1732969..1733328 (+) 360 Protein_1793 Spx/MgsR family RNA polymerase-binding regulatory protein -
  CG450_RS09085 - 1733586..1734425 (+) 840 WP_003183480.1 STAS domain-containing protein -
  CG450_RS09090 comGA 1734582..1735646 (+) 1065 WP_003183477.1 competence type IV pilus ATPase ComGA Machinery gene
  CG450_RS09095 comGB 1735636..1736670 (+) 1035 WP_075218359.1 competence type IV pilus assembly protein ComGB Machinery gene
  CG450_RS09100 comGC 1736684..1736977 (+) 294 WP_003183466.1 competence type IV pilus major pilin ComGC Machinery gene
  CG450_RS09105 comGD 1736983..1737420 (+) 438 WP_009327905.1 competence type IV pilus minor pilin ComGD Machinery gene
  CG450_RS09110 comGE 1737404..1737751 (+) 348 WP_009327907.1 competence type IV pilus minor pilin ComGE -
  CG450_RS09115 comGF 1737777..1738148 (+) 372 WP_003183461.1 competence type IV pilus minor pilin ComGF Machinery gene
  CG450_RS09120 comGG 1738161..1738526 (+) 366 WP_003183459.1 competence type IV pilus minor pilin ComGG -
  CG450_RS09125 - 1738615..1738797 (+) 183 WP_003183456.1 YqzE family protein -
  CG450_RS09130 - 1738821..1739141 (-) 321 WP_003183454.1 YqzG/YhdC family protein -
  CG450_RS09135 tapA 1739418..1740146 (+) 729 WP_003183451.1 amyloid fiber anchoring/assembly protein TapA -
  CG450_RS09140 sipW 1740143..1740727 (+) 585 WP_003183449.1 signal peptidase I SipW -
  CG450_RS09145 tasA 1740801..1741595 (+) 795 WP_003183447.1 biofilm matrix protein TasA -
  CG450_RS09150 sinR 1741700..1742035 (-) 336 WP_025804940.1 transcriptional regulator SinR Regulator
  CG450_RS09155 sinI 1742069..1742245 (-) 177 WP_003183444.1 anti-repressor SinI Regulator

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16249.07 Da        Isoelectric Point: 9.6739

>NTDB_id=200978 CG450_RS09105 WP_009327905.1 1736983..1737420(+) (comGD) [Bacillus licheniformis strain BL-010]
MNQKGFTLLESLTVLMIGSIMFSLLFALLPPIYEKRIVQHFVSQLEEDLLYAQQTALVRHTTVKVQFDFAGCRYIMKHSD
EGSSPELVRTYSCNIAIKKSTLKPILTFNPSGVPNQGGKIVIDTQHASFILTIYLGSGKINVQKK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=200978 CG450_RS09105 WP_009327905.1 1736983..1737420(+) (comGD) [Bacillus licheniformis strain BL-010]
ATGAATCAAAAAGGATTTACGCTTTTGGAAAGTTTAACTGTATTGATGATCGGTTCTATTATGTTCTCTCTTCTCTTTGC
TCTACTGCCTCCCATTTATGAAAAAAGAATCGTTCAGCACTTTGTCTCACAGCTTGAAGAGGATTTGCTTTACGCTCAGC
AGACGGCTCTCGTCCGCCATACGACGGTTAAGGTGCAGTTTGACTTTGCCGGCTGCCGCTATATCATGAAGCATTCGGAC
GAAGGCTCATCGCCTGAACTGGTCAGGACATACAGCTGCAATATCGCAATCAAAAAGTCGACGCTCAAACCAATTCTTAC
TTTTAATCCAAGCGGTGTTCCGAATCAAGGGGGAAAGATCGTGATCGATACACAGCATGCCTCTTTTATACTGACGATCT
ATTTAGGAAGCGGAAAGATTAATGTTCAAAAAAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q8VQ70

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

39.86

98.621

0.393


Multiple sequence alignment