Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | BJI69_RS14265 | Genome accession | NZ_CP017480 |
| Coordinates | 3131651..3132163 (-) | Length | 170 a.a. |
| NCBI ID | WP_046966068.1 | Uniprot ID | A0A0G9HLA6 |
| Organism | Luteibacter rhizovicinus DSM 16549 strain LJ96 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 3126910..3165445 | 3131651..3132163 | within | 0 |
Gene organization within MGE regions
Location: 3126910..3165445
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BJI69_RS14220 (BJI69_14130) | - | 3126910..3128049 (-) | 1140 | WP_046966076.1 | hypothetical protein | - |
| BJI69_RS14230 (BJI69_14140) | - | 3128253..3128489 (-) | 237 | WP_046966074.1 | hypothetical protein | - |
| BJI69_RS14235 (BJI69_14145) | - | 3128489..3129019 (-) | 531 | WP_244465193.1 | DUF1643 domain-containing protein | - |
| BJI69_RS14240 (BJI69_14150) | - | 3129099..3129572 (+) | 474 | WP_156165885.1 | hypothetical protein | - |
| BJI69_RS14245 (BJI69_14155) | - | 3129584..3130102 (-) | 519 | WP_046966072.1 | hypothetical protein | - |
| BJI69_RS14250 (BJI69_14160) | - | 3130099..3130449 (-) | 351 | WP_046966071.1 | hypothetical protein | - |
| BJI69_RS14255 (BJI69_14165) | - | 3130449..3131357 (-) | 909 | WP_046966070.1 | recombination-associated protein RdgC | - |
| BJI69_RS14260 (BJI69_14170) | - | 3131366..3131617 (-) | 252 | WP_046966069.1 | hypothetical protein | - |
| BJI69_RS14265 (BJI69_14175) | ssb | 3131651..3132163 (-) | 513 | WP_046966068.1 | single-stranded DNA-binding protein | Machinery gene |
| BJI69_RS14270 (BJI69_14180) | - | 3132163..3132366 (-) | 204 | WP_046966067.1 | hypothetical protein | - |
| BJI69_RS23055 | - | 3132476..3132604 (-) | 129 | WP_280522617.1 | hypothetical protein | - |
| BJI69_RS14275 (BJI69_14185) | - | 3132601..3132816 (-) | 216 | WP_046966066.1 | hypothetical protein | - |
| BJI69_RS14280 (BJI69_14190) | - | 3132813..3133061 (-) | 249 | WP_046966065.1 | hypothetical protein | - |
| BJI69_RS14285 (BJI69_14195) | - | 3133058..3133306 (-) | 249 | WP_046966064.1 | hypothetical protein | - |
| BJI69_RS14290 (BJI69_14200) | - | 3133303..3133554 (-) | 252 | WP_046966063.1 | hypothetical protein | - |
| BJI69_RS14295 (BJI69_14205) | - | 3133683..3134345 (+) | 663 | WP_052767018.1 | BRCT domain-containing protein | - |
| BJI69_RS14300 (BJI69_14210) | - | 3134402..3135193 (-) | 792 | WP_078023197.1 | helix-turn-helix transcriptional regulator | - |
| BJI69_RS14310 (BJI69_14220) | - | 3135643..3136098 (+) | 456 | WP_046966061.1 | phage regulatory CII family protein | - |
| BJI69_RS14315 (BJI69_14225) | - | 3136515..3136760 (+) | 246 | WP_046966060.1 | hypothetical protein | - |
| BJI69_RS14320 (BJI69_14230) | - | 3136762..3137553 (+) | 792 | WP_052767016.1 | hypothetical protein | - |
| BJI69_RS14325 (BJI69_14235) | dnaB | 3137550..3138899 (+) | 1350 | WP_046966059.1 | replicative DNA helicase | - |
| BJI69_RS14330 (BJI69_14240) | - | 3138889..3139227 (+) | 339 | WP_046966058.1 | hypothetical protein | - |
| BJI69_RS14335 (BJI69_14245) | - | 3139224..3139775 (+) | 552 | WP_078023199.1 | Ref family recombination enhancement nuclease | - |
| BJI69_RS14340 (BJI69_14250) | - | 3139769..3140125 (+) | 357 | WP_046966057.1 | hypothetical protein | - |
| BJI69_RS14345 (BJI69_14255) | - | 3140122..3140349 (+) | 228 | WP_046966056.1 | hypothetical protein | - |
| BJI69_RS14350 (BJI69_14260) | - | 3140359..3141021 (+) | 663 | WP_052767013.1 | hypothetical protein | - |
| BJI69_RS14355 (BJI69_14265) | - | 3141125..3141670 (+) | 546 | WP_046966055.1 | YfbU family protein | - |
| BJI69_RS14360 (BJI69_14270) | - | 3141877..3142410 (+) | 534 | WP_046966054.1 | glycoside hydrolase family 19 protein | - |
| BJI69_RS14365 (BJI69_14275) | - | 3142407..3142751 (+) | 345 | WP_052767012.1 | phage holin family protein | - |
| BJI69_RS14370 (BJI69_14280) | - | 3142732..3143214 (+) | 483 | WP_046966053.1 | hypothetical protein | - |
| BJI69_RS14375 (BJI69_14285) | - | 3143485..3143703 (+) | 219 | WP_211258453.1 | HNH endonuclease signature motif containing protein | - |
| BJI69_RS22345 | - | 3144148..3144360 (+) | 213 | WP_154670749.1 | hypothetical protein | - |
| BJI69_RS14385 (BJI69_14295) | - | 3144365..3146035 (+) | 1671 | WP_046966051.1 | terminase large subunit | - |
| BJI69_RS14390 (BJI69_14300) | - | 3146044..3147333 (+) | 1290 | WP_046966050.1 | phage portal protein | - |
| BJI69_RS14395 (BJI69_14305) | - | 3147347..3148159 (+) | 813 | WP_244465192.1 | head maturation protease, ClpP-related | - |
| BJI69_RS14400 (BJI69_14310) | - | 3148156..3149397 (+) | 1242 | WP_211258452.1 | phage major capsid protein | - |
| BJI69_RS14405 (BJI69_14315) | - | 3149459..3149776 (+) | 318 | WP_046966048.1 | hypothetical protein | - |
| BJI69_RS14410 (BJI69_14320) | - | 3149779..3150258 (+) | 480 | WP_046966047.1 | head-tail connector protein | - |
| BJI69_RS14415 (BJI69_14325) | - | 3150255..3150596 (+) | 342 | WP_046966046.1 | phage head closure protein | - |
| BJI69_RS14420 (BJI69_14330) | - | 3150589..3150801 (+) | 213 | WP_046966045.1 | hypothetical protein | - |
| BJI69_RS14425 (BJI69_14335) | - | 3150794..3151300 (+) | 507 | WP_046966044.1 | HK97 gp10 family phage protein | - |
| BJI69_RS14430 (BJI69_14340) | - | 3151297..3151653 (+) | 357 | WP_046966043.1 | DUF3168 domain-containing protein | - |
| BJI69_RS14435 (BJI69_14345) | - | 3151755..3152417 (+) | 663 | WP_046966042.1 | phage tail tube protein | - |
| BJI69_RS14440 (BJI69_14350) | - | 3152414..3152716 (+) | 303 | WP_046966041.1 | phage tail assembly chaperone | - |
| BJI69_RS14445 (BJI69_14355) | - | 3152779..3153024 (+) | 246 | WP_046966040.1 | DUF1799 domain-containing protein | - |
| BJI69_RS14450 (BJI69_14360) | - | 3153028..3155631 (+) | 2604 | WP_046966039.1 | phage tail tape measure protein | - |
| BJI69_RS14455 (BJI69_14365) | - | 3155628..3155960 (+) | 333 | WP_046966141.1 | phage tail protein | - |
| BJI69_RS14460 (BJI69_14370) | - | 3155957..3156664 (+) | 708 | WP_046966038.1 | phage minor tail protein L | - |
| BJI69_RS22915 | - | 3156664..3156897 (+) | 234 | Protein_2849 | C40 family peptidase | - |
| BJI69_RS22920 | - | 3156943..3157389 (+) | 447 | WP_244890722.1 | NlpC/P60 family protein | - |
| BJI69_RS14470 (BJI69_14380) | - | 3157417..3157848 (+) | 432 | WP_046966036.1 | hypothetical protein | - |
| BJI69_RS14475 (BJI69_14385) | - | 3157905..3158588 (+) | 684 | WP_071924981.1 | tail assembly protein | - |
| BJI69_RS14480 (BJI69_14390) | - | 3158649..3162227 (+) | 3579 | WP_046966035.1 | phage tail protein | - |
| BJI69_RS14485 (BJI69_14395) | - | 3162239..3162511 (+) | 273 | WP_125903063.1 | hypothetical protein | - |
| BJI69_RS14490 (BJI69_14400) | - | 3162511..3163152 (+) | 642 | WP_046966033.1 | hypothetical protein | - |
| BJI69_RS14495 (BJI69_14405) | - | 3163160..3164254 (+) | 1095 | WP_046966032.1 | hypothetical protein | - |
| BJI69_RS14500 (BJI69_14410) | - | 3164257..3164721 (+) | 465 | WP_046966031.1 | hypothetical protein | - |
| BJI69_RS14505 (BJI69_14415) | - | 3164756..3165445 (+) | 690 | WP_046966030.1 | SOS response-associated peptidase | - |
Sequence
Protein
Download Length: 170 a.a. Molecular weight: 18792.67 Da Isoelectric Point: 5.3971
>NTDB_id=198657 BJI69_RS14265 WP_046966068.1 3131651..3132163(-) (ssb) [Luteibacter rhizovicinus DSM 16549 strain LJ96]
MARGINKVIIVGNLGADPETRYTGSGTAITSLRIATSEAWTDKASGEKQERTEWHRVKLFGKLAEIAGEYLKKGRQVYIE
GSLRTDKYTDKDGIERYSTDIIGNEMQMLGGQPSERPADRYGESRYGGGERASGGKGRAQRDFEQRAHDTPPQSTGTPAN
EEFDDDTIPF
MARGINKVIIVGNLGADPETRYTGSGTAITSLRIATSEAWTDKASGEKQERTEWHRVKLFGKLAEIAGEYLKKGRQVYIE
GSLRTDKYTDKDGIERYSTDIIGNEMQMLGGQPSERPADRYGESRYGGGERASGGKGRAQRDFEQRAHDTPPQSTGTPAN
EEFDDDTIPF
Nucleotide
Download Length: 513 bp
>NTDB_id=198657 BJI69_RS14265 WP_046966068.1 3131651..3132163(-) (ssb) [Luteibacter rhizovicinus DSM 16549 strain LJ96]
ATGGCTCGCGGCATCAACAAAGTAATCATCGTCGGCAACCTCGGCGCCGATCCTGAGACGCGATACACGGGCAGCGGCAC
GGCCATCACGTCGCTGCGCATCGCGACCTCTGAAGCCTGGACCGACAAGGCCTCCGGCGAGAAGCAGGAGCGCACTGAGT
GGCACCGCGTGAAGCTGTTCGGAAAGCTCGCCGAGATCGCAGGCGAGTACCTGAAGAAAGGTCGCCAGGTCTACATCGAA
GGCTCGCTGCGCACCGACAAGTACACCGACAAGGACGGCATCGAGCGCTACTCGACCGACATCATCGGCAACGAGATGCA
GATGCTCGGCGGCCAGCCTTCGGAGCGTCCGGCAGACCGTTACGGCGAATCGCGCTATGGCGGTGGTGAGCGCGCCAGCG
GCGGGAAGGGTCGCGCGCAGCGTGACTTCGAGCAGCGCGCGCACGACACGCCGCCCCAGTCCACCGGTACTCCGGCCAAC
GAAGAATTCGACGACGACACGATTCCCTTTTAG
ATGGCTCGCGGCATCAACAAAGTAATCATCGTCGGCAACCTCGGCGCCGATCCTGAGACGCGATACACGGGCAGCGGCAC
GGCCATCACGTCGCTGCGCATCGCGACCTCTGAAGCCTGGACCGACAAGGCCTCCGGCGAGAAGCAGGAGCGCACTGAGT
GGCACCGCGTGAAGCTGTTCGGAAAGCTCGCCGAGATCGCAGGCGAGTACCTGAAGAAAGGTCGCCAGGTCTACATCGAA
GGCTCGCTGCGCACCGACAAGTACACCGACAAGGACGGCATCGAGCGCTACTCGACCGACATCATCGGCAACGAGATGCA
GATGCTCGGCGGCCAGCCTTCGGAGCGTCCGGCAGACCGTTACGGCGAATCGCGCTATGGCGGTGGTGAGCGCGCCAGCG
GCGGGAAGGGTCGCGCGCAGCGTGACTTCGAGCAGCGCGCGCACGACACGCCGCCCCAGTCCACCGGTACTCCGGCCAAC
GAAGAATTCGACGACGACACGATTCCCTTTTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
48.619 |
100 |
0.518 |
| ssb | Neisseria meningitidis MC58 |
44.382 |
100 |
0.465 |
| ssb | Neisseria gonorrhoeae MS11 |
44.382 |
100 |
0.465 |
| ssb | Glaesserella parasuis strain SC1401 |
40.642 |
100 |
0.447 |