Detailed information    

insolico Bioinformatically predicted

Overview


Name   sepM   Type   Regulator
Locus tag   BBD27_RS06225 Genome accession   NZ_CP016394
Coordinates   1164807..1165883 (+) Length   358 a.a.
NCBI ID   WP_011681549.1    Uniprot ID   -
Organism   Streptococcus thermophilus strain ND07     
Function   processing of CSP (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1101709..1171201 1164807..1165883 within 0


Gene organization within MGE regions


Location: 1101709..1171201
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BBD27_RS05910 (BBD27_1156) addA 1102614..1106267 (+) 3654 WP_024703999.1 helicase-exonuclease AddAB subunit AddA -
  BBD27_RS05915 (BBD27_1157) - 1106619..1107350 (-) 732 WP_014608678.1 DUF554 domain-containing protein -
  BBD27_RS05920 (BBD27_1158) - 1107625..1108356 (+) 732 WP_002891761.1 ABC transporter ATP-binding protein -
  BBD27_RS05925 (BBD27_1159) - 1108359..1109948 (+) 1590 WP_014608677.1 ABC transporter permease -
  BBD27_RS05930 (BBD27_1160) proB 1110069..1110872 (+) 804 WP_014621941.1 glutamate 5-kinase -
  BBD27_RS05935 (BBD27_1161) - 1110874..1112124 (+) 1251 WP_014621940.1 glutamate-5-semialdehyde dehydrogenase -
  BBD27_RS05940 (BBD27_1162) - 1112458..1112748 (+) 291 WP_014621939.1 hypothetical protein -
  BBD27_RS05945 (BBD27_1163) - 1112968..1113324 (+) 357 WP_014621938.1 DUF805 domain-containing protein -
  BBD27_RS11480 - 1113598..1113741 (+) 144 WP_014621937.1 hypothetical protein -
  BBD27_RS11750 - 1113815..1113946 (+) 132 WP_014621936.1 hypothetical protein -
  BBD27_RS11485 (BBD27_1164) - 1113961..1114347 (+) 387 WP_011681587.1 hypothetical protein -
  BBD27_RS11490 - 1114344..1114559 (+) 216 WP_011681586.1 hypothetical protein -
  BBD27_RS11495 (BBD27_ps37) - 1114525..1114953 (+) 429 WP_011681585.1 hypothetical protein -
  BBD27_RS05970 (BBD27_1165) rsmH 1115119..1116069 (+) 951 WP_014621931.1 16S rRNA (cytosine(1402)-N(4))-methyltransferase RsmH -
  BBD27_RS05975 (BBD27_1166) ftsL 1116072..1116392 (+) 321 WP_002948801.1 cell division protein FtsL -
  BBD27_RS05980 (BBD27_1167) pbp2X 1116396..1118663 (+) 2268 WP_011681584.1 penicillin-binding protein PBP2X -
  BBD27_RS05985 (BBD27_1168) mraY 1118665..1119687 (+) 1023 WP_011227524.1 phospho-N-acetylmuramoyl-pentapeptide- transferase -
  BBD27_RS05990 (BBD27_1169) - 1119762..1121105 (+) 1344 WP_014608670.1 DEAD/DEAH box helicase -
  BBD27_RS05995 (BBD27_1171) - 1121953..1123308 (+) 1356 WP_002948886.1 bifunctional metallophosphatase/5'-nucleotidase -
  BBD27_RS06000 (BBD27_1172) - 1123363..1124085 (+) 723 WP_024703996.1 YutD family protein -
  BBD27_RS06005 (BBD27_1173) rlmN 1124089..1125258 (+) 1170 WP_011226504.1 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN -
  BBD27_RS06010 (BBD27_1174) - 1125260..1125787 (+) 528 WP_011226503.1 VanZ family protein -
  BBD27_RS11500 (BBD27_1175) - 1125992..1126198 (+) 207 WP_002948879.1 hypothetical protein -
  BBD27_RS06020 (BBD27_1176) - 1126386..1128143 (+) 1758 WP_024703995.1 ABC transporter ATP-binding protein -
  BBD27_RS06025 (BBD27_1177) - 1128136..1129881 (+) 1746 WP_024703994.1 ABC transporter ATP-binding protein -
  BBD27_RS06030 (BBD27_ps38) - 1130895..1133047 (+) 2153 Protein_1122 peptide cleavage/export ABC transporter -
  BBD27_RS06035 (BBD27_1180) - 1133063..1134430 (+) 1368 WP_011681574.1 bacteriocin secretion accessory protein -
  BBD27_RS06040 (BBD27_1181) - 1134445..1134606 (+) 162 WP_011681573.1 ComC/BlpC family leader-containing pheromone/bacteriocin -
  BBD27_RS11505 - 1134624..1135151 (-) 528 WP_231107203.1 ATP-binding protein -
  BBD27_RS06050 (BBD27_1183) - 1135964..1136695 (-) 732 WP_002948869.1 LytR/AlgR family response regulator transcription factor -
  BBD27_RS06055 (BBD27_1184) - 1136951..1137127 (+) 177 WP_011681570.1 Blp family class II bacteriocin -
  BBD27_RS06060 (BBD27_1185) - 1137146..1137346 (+) 201 WP_011681569.1 hypothetical protein -
  BBD27_RS06065 (BBD27_1186) - 1137702..1137932 (+) 231 WP_014608662.1 bacteriocin class II family protein -
  BBD27_RS11870 - 1138937..1139338 (+) 402 WP_024703992.1 hypothetical protein -
  BBD27_RS06080 (BBD27_1189) - 1139589..1139843 (+) 255 WP_014608660.1 Blp family class II bacteriocin -
  BBD27_RS06095 (BBD27_1192) - 1141750..1142442 (+) 693 WP_224103184.1 thioredoxin family protein -
  BBD27_RS06100 (BBD27_1193) - 1142473..1142679 (+) 207 WP_011681562.1 hypothetical protein -
  BBD27_RS06105 (BBD27_1194) - 1142844..1143140 (+) 297 WP_004197070.1 bacteriocin immunity protein -
  BBD27_RS10780 - 1143462..1143725 (+) 264 WP_002945924.1 hypothetical protein -
  BBD27_RS06110 - 1143850..1144230 (+) 381 WP_002951783.1 hypothetical protein -
  BBD27_RS06115 (BBD27_1196) - 1144310..1146577 (-) 2268 WP_011681561.1 Xaa-Pro dipeptidyl-peptidase -
  BBD27_RS06120 (BBD27_1197) gla 1146698..1147561 (+) 864 WP_002951781.1 aquaglyceroporin Gla -
  BBD27_RS06125 (BBD27_1198) - 1147648..1148010 (-) 363 WP_014608659.1 CPBP family intramembrane glutamic endopeptidase -
  BBD27_RS06130 (BBD27_1199) - 1148292..1149047 (+) 756 WP_011681560.1 CppA family protein -
  BBD27_RS06135 (BBD27_1200) - 1149047..1150003 (+) 957 WP_024703991.1 serine hydrolase domain-containing protein -
  BBD27_RS06140 (BBD27_1202) - 1150206..1150856 (+) 651 WP_024703990.1 ABC transporter ATP-binding protein -
  BBD27_RS06145 (BBD27_1203) - 1150853..1151608 (+) 756 WP_011681558.1 ABC transporter permease -
  BBD27_RS11875 (BBD27_1204) mobV 1152053..1152561 (+) 509 Protein_1145 MobV family relaxase -
  BBD27_RS06160 (BBD27_1205) - 1152586..1152891 (+) 306 WP_014621914.1 restriction endonuclease subunit S -
  BBD27_RS06165 (BBD27_1206) - 1153242..1153694 (-) 453 WP_014608655.1 GNAT family N-acetyltransferase -
  BBD27_RS06170 (BBD27_1207) - 1153745..1154527 (-) 783 WP_011681555.1 carbonic anhydrase -
  BBD27_RS06175 (BBD27_1208) pflB 1154794..1157103 (-) 2310 WP_011226473.1 formate C-acetyltransferase -
  BBD27_RS06180 (BBD27_1209) dinB 1157382..1158485 (+) 1104 WP_014608654.1 DNA polymerase IV -
  BBD27_RS06185 (BBD27_1210) - 1158783..1159016 (+) 234 WP_002947030.1 hypothetical protein -
  BBD27_RS06190 (BBD27_1211) - 1159476..1160306 (+) 831 WP_014608653.1 transporter substrate-binding domain-containing protein -
  BBD27_RS06195 (BBD27_1212) - 1160694..1161440 (+) 747 WP_100284797.1 amino acid ABC transporter permease -
  BBD27_RS06200 (BBD27_1213) - 1161440..1162183 (+) 744 WP_014608652.1 amino acid ABC transporter ATP-binding protein -
  BBD27_RS06205 (BBD27_1214) - 1162398..1162622 (+) 225 WP_014621911.1 DUF4059 family protein -
  BBD27_RS06210 (BBD27_1215) trxB 1162655..1163608 (+) 954 WP_255136104.1 thioredoxin-disulfide reductase -
  BBD27_RS06215 (BBD27_1216) rsmD 1163699..1164298 (+) 600 Protein_1157 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD -
  BBD27_RS06220 (BBD27_1217) coaD 1164332..1164829 (+) 498 WP_011681550.1 pantetheine-phosphate adenylyltransferase -
  BBD27_RS06225 (BBD27_1218) sepM 1164807..1165883 (+) 1077 WP_011681549.1 SepM family pheromone-processing serine protease Regulator
  BBD27_RS06230 (BBD27_1219) - 1165968..1166912 (+) 945 WP_011226463.1 TIGR01212 family radical SAM protein -
  BBD27_RS06235 (BBD27_1220) - 1166909..1167457 (+) 549 WP_011226462.1 tRNA (mnm(5)s(2)U34)-methyltransferase -
  BBD27_RS06240 (BBD27_1221) - 1167454..1167696 (+) 243 WP_011226461.1 hypothetical protein -
  BBD27_RS06245 (BBD27_1222) - 1167705..1169771 (+) 2067 WP_011681548.1 cation:proton antiporter -
  BBD27_RS06250 (BBD27_1223) - 1170393..1171175 (-) 783 WP_024703988.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 358 a.a.        Molecular weight: 39172.02 Da        Isoelectric Point: 9.3888

>NTDB_id=187851 BBD27_RS06225 WP_011681549.1 1164807..1165883(+) (sepM) [Streptococcus thermophilus strain ND07]
MANKTKSKALLEKMWRIKWWLLSIFTVLFLLFALFFPLNNYYVELPGGAFDTKEVLTVNKKADDSKGSYNFVAVAQTKAT
LALMLYAQFNDFAKLQTAEEATGNYSDEDFMRINQFYMETSQNQAVYQGLTLAGKEVSLEYMGVYVLQVADDSSFKGVLN
IADTVTAVNGNTFDNSTDMIKYVQGLKLGSKVKVTYMRDGKEKTATGKIIKIANGKNGIGIGLTDHTEIKSPENVKFKLD
GVGGPSAGLMFTLAIYDQVSGQDLKAGRKIAGTGTIEKDGAVGDIGGAYLKVKSAADSGADIFFVPNNLVTKEMKKADPD
AKTNYQEAKEAAEKLGTKMKIVPVKTAQEAIDYLKKTK

Nucleotide


Download         Length: 1077 bp        

>NTDB_id=187851 BBD27_RS06225 WP_011681549.1 1164807..1165883(+) (sepM) [Streptococcus thermophilus strain ND07]
GTGGCAAACAAGACAAAATCTAAAGCGCTATTAGAGAAAATGTGGCGTATTAAGTGGTGGTTATTAAGTATTTTTACGGT
ACTTTTCCTCCTTTTTGCCCTCTTTTTCCCGCTCAATAATTACTATGTGGAGCTTCCGGGTGGTGCTTTTGATACCAAGG
AAGTCTTGACAGTGAATAAGAAAGCTGATGATTCTAAGGGCTCCTATAATTTTGTGGCGGTGGCTCAAACCAAGGCGACT
TTGGCCTTGATGCTCTATGCTCAGTTTAATGATTTTGCAAAGCTTCAAACGGCTGAAGAGGCAACTGGAAATTACTCTGA
TGAAGATTTCATGCGCATCAACCAATTTTACATGGAGACTTCTCAAAACCAAGCGGTTTATCAGGGCTTGACTCTGGCTG
GTAAGGAGGTTAGTTTGGAGTATATGGGTGTCTATGTGCTTCAGGTTGCTGATGATTCTAGCTTCAAGGGTGTCCTCAAT
ATTGCTGATACGGTGACGGCTGTTAATGGTAATACCTTTGATAATTCTACTGACATGATTAAATACGTTCAAGGACTTAA
GCTGGGTTCAAAGGTCAAGGTCACTTATATGAGAGATGGCAAAGAAAAGACTGCTACTGGTAAGATTATTAAGATTGCCA
ATGGCAAAAATGGTATTGGTATCGGCCTAACGGACCATACTGAGATCAAGAGTCCTGAGAATGTTAAGTTTAAACTGGAT
GGTGTCGGTGGGCCAAGTGCTGGTCTTATGTTTACCTTGGCTATTTACGATCAGGTGTCTGGTCAAGACCTCAAGGCTGG
CCGCAAGATTGCTGGTACAGGAACTATTGAAAAAGATGGGGCTGTCGGTGATATCGGTGGGGCCTATCTCAAGGTGAAAT
CTGCGGCTGATAGTGGCGCAGACATTTTCTTCGTGCCAAATAATCTAGTAACTAAGGAAATGAAAAAGGCTGATCCGGAT
GCCAAGACTAATTATCAAGAGGCCAAGGAAGCTGCCGAGAAACTGGGGACCAAGATGAAAATCGTCCCTGTTAAAACAGC
TCAAGAAGCCATTGATTATTTGAAAAAGACTAAATGA

Domains


Predicted by InterproScan.

(137-206)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sepM Streptococcus mutans UA159

62.757

95.251

0.598


Multiple sequence alignment