Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   AYM34_RS11410 Genome accession   NZ_CP014435
Coordinates   2162834..2163304 (-) Length   156 a.a.
NCBI ID   WP_050961221.1    Uniprot ID   -
Organism   Staphylococcus aureus strain USA300-SUR21     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2133134..2189082 2162834..2163304 within 0


Gene organization within MGE regions


Location: 2133134..2189082
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AYM34_RS11180 (AYM34_10905) scn 2133134..2133484 (-) 351 WP_000702263.1 complement inhibitor SCIN-A -
  AYM34_RS11185 (AYM34_10910) - 2134169..2134618 (+) 450 WP_000727649.1 chemotaxis-inhibiting protein CHIPS -
  AYM34_RS15785 (AYM34_10915) - 2134713..2135048 (-) 336 Protein_2083 SH3 domain-containing protein -
  AYM34_RS11210 (AYM34_10920) sak 2135698..2136189 (-) 492 WP_000919350.1 staphylokinase -
  AYM34_RS11215 (AYM34_10925) - 2136380..2137135 (-) 756 WP_000861038.1 CHAP domain-containing protein -
  AYM34_RS11220 (AYM34_10930) - 2137147..2137401 (-) 255 WP_000611512.1 phage holin -
  AYM34_RS11225 (AYM34_10935) - 2137453..2137560 (+) 108 WP_001791821.1 hypothetical protein -
  AYM34_RS11230 pepG1 2137613..2137747 (-) 135 WP_000226108.1 type I toxin-antitoxin system toxin PepG1 -
  AYM34_RS11235 (AYM34_10940) - 2137939..2138235 (-) 297 WP_000539688.1 DUF2951 domain-containing protein -
  AYM34_RS11240 (AYM34_10945) - 2138293..2138580 (-) 288 WP_001040261.1 hypothetical protein -
  AYM34_RS11245 (AYM34_10950) - 2138627..2138779 (-) 153 WP_001153681.1 hypothetical protein -
  AYM34_RS11250 (AYM34_10955) - 2138769..2142554 (-) 3786 WP_077467069.1 phage tail spike protein -
  AYM34_RS11255 (AYM34_10960) - 2142570..2144054 (-) 1485 WP_000567394.1 phage tail domain-containing protein -
  AYM34_RS11260 (AYM34_10965) - 2144051..2148580 (-) 4530 WP_001549166.1 phage tail tape measure protein -
  AYM34_RS15955 - 2148637..2148774 (-) 138 WP_001549167.1 hypothetical protein -
  AYM34_RS11265 (AYM34_10970) - 2148825..2149175 (-) 351 WP_001096354.1 hypothetical protein -
  AYM34_RS11270 - 2149225..2149464 (-) 240 WP_094969769.1 Ig-like domain-containing protein -
  AYM34_RS11275 (AYM34_10975) - 2149491..2150135 (-) 645 WP_000260578.1 major tail protein -
  AYM34_RS11280 (AYM34_10980) - 2150139..2150543 (-) 405 WP_000565500.1 hypothetical protein -
  AYM34_RS11285 (AYM34_10985) - 2150540..2150944 (-) 405 WP_000114229.1 HK97 gp10 family phage protein -
  AYM34_RS11290 (AYM34_10990) - 2150941..2151303 (-) 363 WP_000755150.1 head-tail adaptor protein -
  AYM34_RS11295 (AYM34_10995) - 2151287..2151571 (-) 285 WP_000150936.1 phage head-tail adapter protein -
  AYM34_RS11300 (AYM34_11000) - 2151561..2151845 (-) 285 WP_000238236.1 hypothetical protein -
  AYM34_RS11305 (AYM34_11005) - 2151865..2153010 (-) 1146 WP_000154559.1 phage major capsid protein -
  AYM34_RS11310 (AYM34_11010) - 2153034..2153771 (-) 738 WP_000642728.1 head maturation protease, ClpP-related -
  AYM34_RS11315 (AYM34_11015) - 2153755..2154942 (-) 1188 WP_000025274.1 phage portal protein -
  AYM34_RS11320 (AYM34_11020) - 2154958..2156619 (-) 1662 WP_000625088.1 terminase large subunit -
  AYM34_RS11325 (AYM34_11025) - 2156616..2156960 (-) 345 WP_000402904.1 hypothetical protein -
  AYM34_RS11330 (AYM34_11030) - 2157090..2157389 (-) 300 WP_000988336.1 HNH endonuclease -
  AYM34_RS11335 (AYM34_11035) - 2157621..2158037 (-) 417 WP_000590122.1 hypothetical protein -
  AYM34_RS11340 (AYM34_11040) - 2158065..2158265 (-) 201 WP_000265043.1 DUF1514 family protein -
  AYM34_RS11345 (AYM34_11045) - 2158265..2158414 (-) 150 WP_000595265.1 transcriptional activator RinB -
  AYM34_RS11350 (AYM34_11050) - 2158411..2158797 (-) 387 WP_000592207.1 hypothetical protein -
  AYM34_RS11355 (AYM34_11055) - 2158794..2159000 (-) 207 WP_000195803.1 DUF1381 domain-containing protein -
  AYM34_RS11360 (AYM34_11060) - 2158997..2159242 (-) 246 WP_001282074.1 hypothetical protein -
  AYM34_RS11365 (AYM34_11065) - 2159279..2159812 (-) 534 WP_000181819.1 dUTP pyrophosphatase -
  AYM34_RS11370 (AYM34_11070) - 2159805..2160047 (-) 243 WP_000700108.1 hypothetical protein -
  AYM34_RS11375 (AYM34_11075) - 2160037..2160273 (-) 237 WP_001065101.1 DUF1024 family protein -
  AYM34_RS11380 (AYM34_11080) - 2160266..2160637 (-) 372 WP_001549172.1 hypothetical protein -
  AYM34_RS11385 (AYM34_11085) - 2160646..2160888 (-) 243 WP_000131383.1 phi PVL orf 51-like protein -
  AYM34_RS11390 (AYM34_11090) - 2160892..2161260 (-) 369 WP_000101288.1 SA1788 family PVL leukocidin-associated protein -
  AYM34_RS11395 (AYM34_11095) - 2161273..2161677 (-) 405 WP_000401977.1 RusA family crossover junction endodeoxyribonuclease -
  AYM34_RS11400 (AYM34_11100) - 2161686..2161904 (-) 219 WP_000338530.1 hypothetical protein -
  AYM34_RS11405 (AYM34_11105) - 2161911..2162804 (-) 894 WP_000148333.1 DnaD domain-containing protein -
  AYM34_RS11410 (AYM34_11110) ssbA 2162834..2163304 (-) 471 WP_050961221.1 single-stranded DNA-binding protein Machinery gene
  AYM34_RS11415 (AYM34_11115) - 2163305..2163922 (-) 618 WP_071665632.1 MBL fold metallo-hydrolase -
  AYM34_RS11420 (AYM34_11120) - 2164003..2164923 (-) 921 WP_000138475.1 recombinase RecT -
  AYM34_RS11425 (AYM34_11125) - 2164925..2166868 (-) 1944 WP_000700561.1 AAA family ATPase -
  AYM34_RS11430 - 2166877..2167140 (-) 264 WP_001205732.1 hypothetical protein -
  AYM34_RS11435 (AYM34_11130) - 2167149..2167409 (-) 261 WP_000291513.1 DUF1108 family protein -
  AYM34_RS11440 (AYM34_11135) - 2167390..2167709 (-) 320 Protein_2131 DUF2482 family protein -
  AYM34_RS11445 (AYM34_11140) - 2167804..2167965 (-) 162 WP_001285960.1 DUF1270 domain-containing protein -
  AYM34_RS11450 (AYM34_11145) - 2167962..2168282 (-) 321 WP_001120199.1 DUF771 domain-containing protein -
  AYM34_RS11455 (AYM34_11150) - 2168341..2168571 (+) 231 WP_000549548.1 hypothetical protein -
  AYM34_RS15960 - 2168568..2168744 (-) 177 WP_001001356.1 hypothetical protein -
  AYM34_RS11460 (AYM34_11155) - 2168760..2169512 (-) 753 WP_001148642.1 phage antirepressor KilAC domain-containing protein -
  AYM34_RS11465 (AYM34_11160) - 2169563..2169892 (+) 330 WP_000180411.1 hypothetical protein -
  AYM34_RS11470 (AYM34_11165) - 2169881..2170096 (-) 216 WP_001025404.1 MW1434 family type I TA system toxin -
  AYM34_RS11475 (AYM34_11170) - 2170112..2170375 (-) 264 WP_000854072.1 helix-turn-helix transcriptional regulator -
  AYM34_RS11480 (AYM34_11175) - 2170372..2170545 (-) 174 WP_001801500.1 hypothetical protein -
  AYM34_RS11485 (AYM34_11180) - 2170508..2171221 (+) 714 WP_001031454.1 XRE family transcriptional regulator -
  AYM34_RS11490 (AYM34_11185) - 2171237..2172169 (+) 933 WP_000759682.1 exonuclease domain-containing protein -
  AYM34_RS11495 (AYM34_11190) - 2172175..2172516 (+) 342 WP_000591749.1 hypothetical protein -
  AYM34_RS11500 (AYM34_11195) - 2172720..2172902 (+) 183 WP_000705246.1 hypothetical protein -
  AYM34_RS11505 (AYM34_11200) - 2172980..2173693 (+) 714 WP_001549185.1 type II toxin-antitoxin system PemK/MazF family toxin -
  AYM34_RS11510 (AYM34_11205) - 2173884..2174921 (+) 1038 WP_000857199.1 site-specific integrase -
  AYM34_RS11515 (AYM34_11210) sph 2174972..2175802 (+) 831 Protein_2147 sphingomyelin phosphodiesterase -
  AYM34_RS11520 (AYM34_11215) lukG 2176040..2177056 (-) 1017 WP_000595324.1 bi-component leukocidin LukGH subunit G -
  AYM34_RS11525 (AYM34_11220) lukH 2177078..2178133 (-) 1056 WP_000791407.1 bi-component leukocidin LukGH subunit H -
  AYM34_RS11530 (AYM34_11225) - 2178568..2179791 (+) 1224 WP_000206639.1 ArgE/DapE family deacylase -
  AYM34_RS11540 (AYM34_11230) - 2180163..2181008 (-) 846 WP_000812010.1 class I SAM-dependent methyltransferase -
  AYM34_RS11545 (AYM34_11235) - 2181070..2181981 (-) 912 WP_000825510.1 iron-hydroxamate ABC transporter substrate-binding protein -
  AYM34_RS11550 (AYM34_11240) - 2182142..2183449 (+) 1308 WP_001045079.1 TrkH family potassium uptake protein -
  AYM34_RS11560 (AYM34_11245) - 2184302..2184745 (-) 444 WP_000022887.1 GNAT family N-acetyltransferase -
  AYM34_RS11565 (AYM34_11250) - 2184851..2185287 (-) 437 Protein_2155 hypothetical protein -
  AYM34_RS11570 (AYM34_11255) - 2185605..2186195 (-) 591 WP_001293058.1 terminase small subunit -
  AYM34_RS11575 (AYM34_11260) - 2186192..2186404 (-) 213 WP_000128898.1 hypothetical protein -
  AYM34_RS11580 - 2186465..2187011 (+) 547 Protein_2158 site-specific integrase -
  AYM34_RS11585 (AYM34_11270) groL 2187106..2188722 (-) 1617 WP_000240645.1 chaperonin GroEL -
  AYM34_RS11590 (AYM34_11275) groES 2188798..2189082 (-) 285 WP_000917289.1 co-chaperone GroES -

Sequence


Protein


Download         Length: 156 a.a.        Molecular weight: 17625.52 Da        Isoelectric Point: 4.9432

>NTDB_id=171544 AYM34_RS11410 WP_050961221.1 2162834..2163304(-) (ssbA) [Staphylococcus aureus strain USA300-SUR21]
MLNRTILVGRLTRDPELRTTQNGVNVASFTLAVNRTFTNAQGELEADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF

Nucleotide


Download         Length: 471 bp        

>NTDB_id=171544 AYM34_RS11410 WP_050961221.1 2162834..2163304(-) (ssbA) [Staphylococcus aureus strain USA300-SUR21]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAATGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCTCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

55.932

100

0.635

  ssb Latilactobacillus sakei subsp. sakei 23K

49.412

100

0.538

  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

67.949

0.404

  ssb Glaesserella parasuis strain SC1401

32.768

100

0.372

  ssb Neisseria meningitidis MC58

32.948

100

0.365

  ssb Neisseria gonorrhoeae MS11

32.948

100

0.365


Multiple sequence alignment