Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   BKN48_RS05200 Genome accession   NZ_CP017676
Coordinates   945980..946120 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain VV2     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 940980..951120
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BKN48_RS05175 (BKN48_05175) yuxO 941293..941673 (-) 381 WP_014477831.1 hotdog fold thioesterase -
  BKN48_RS05180 (BKN48_05180) comA 941692..942336 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  BKN48_RS05185 (BKN48_05185) comP 942417..944723 (-) 2307 WP_070547703.1 two-component system sensor histidine kinase ComP Regulator
  BKN48_RS05190 (BKN48_05190) comX 944740..944913 (-) 174 WP_021480497.1 competence pheromone ComX Regulator
  BKN48_RS05195 (BKN48_05195) comQ 944929..945795 (-) 867 WP_021480498.1 polyprenyl synthetase family protein Regulator
  BKN48_RS05200 (BKN48_05200) degQ 945980..946120 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  BKN48_RS21455 - 946342..946404 (+) 63 Protein_1014 hypothetical protein -
  BKN48_RS05205 (BKN48_05205) - 946582..946950 (+) 369 WP_038828672.1 hypothetical protein -
  BKN48_RS05210 (BKN48_05210) pdeH 946926..948155 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  BKN48_RS05215 (BKN48_05215) pncB 948292..949764 (-) 1473 WP_070547704.1 nicotinate phosphoribosyltransferase -
  BKN48_RS05220 (BKN48_05220) pncA 949780..950331 (-) 552 WP_014477836.1 cysteine hydrolase family protein -
  BKN48_RS05225 (BKN48_05225) yueI 950428..950826 (-) 399 WP_014480710.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=170605 BKN48_RS05200 WP_003220708.1 945980..946120(-) (degQ) [Bacillus subtilis strain VV2]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=170605 BKN48_RS05200 WP_003220708.1 945980..946120(-) (degQ) [Bacillus subtilis strain VV2]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1