Detailed information NTG0160399

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: SA40TW_RS07840
• Genome accession: NZ_CP013182
• Coordinates: 1565905..1566216 (-)
• Length: 103 a.a.
• NCBI ID: WP_000472256.1
• Uniprot ID: -
• Organism: Staphylococcus aureus strain SA40TW
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1560905..1571216

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
SA40TW_RS07805 (SA40TW_07475)	gcvPA	1561407..1562753 (-)	1347	WP_000019687.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-
SA40TW_RS07810 (SA40TW_07480)	gcvT	1562773..1563864 (-)	1092	WP_000093349.1	glycine cleavage system aminomethyltransferase GcvT	-
SA40TW_RS07815 (SA40TW_07485)	-	1564023..1564547 (-)	525	WP_001015116.1	shikimate kinase	-
SA40TW_RS07820 (SA40TW_07490)	-	1564537..1564683 (-)	147	WP_001789879.1	hypothetical protein	-
SA40TW_RS07825 (SA40TW_07495)	comGF	1564780..1565277 (-)	498	WP_001838632.1	competence type IV pilus minor pilin ComGF	Machinery gene
SA40TW_RS07830 (SA40TW_07500)	comGE	1565195..1565494 (-)	300	WP_000844413.1	hypothetical protein	Machinery gene
SA40TW_RS07835 (SA40TW_07505)	comGD	1565481..1565927 (-)	447	WP_001796473.1	competence type IV pilus minor pilin ComGD	Machinery gene
SA40TW_RS07840 (SA40TW_07510)	comGC	1565905..1566216 (-)	312	WP_000472256.1	competence type IV pilus major pilin ComGC	Machinery gene
SA40TW_RS07845 (SA40TW_07515)	comGB	1566230..1567300 (-)	1071	WP_000776407.1	competence type IV pilus assembly protein ComGB	Machinery gene
SA40TW_RS07850 (SA40TW_07520)	comGA	1567272..1568246 (-)	975	WP_000697218.1	competence type IV pilus ATPase ComGA	Machinery gene
SA40TW_RS07855 (SA40TW_07525)	-	1568298..1568921 (-)	624	WP_001223008.1	MBL fold metallo-hydrolase	-
SA40TW_RS07860 (SA40TW_07530)	-	1568918..1569247 (-)	330	WP_001018871.1	MTH1187 family thiamine-binding protein	-
SA40TW_RS07865 (SA40TW_07535)	-	1569247..1570233 (-)	987	WP_000161315.1	ROK family glucokinase	-
SA40TW_RS07870 (SA40TW_07540)	-	1570230..1570433 (-)	204	WP_000087561.1	YqgQ family protein	-

Sequence

Protein

• Length: 103 a.a.
• Molecular weight: 11315.36 Da
• Isoelectric Point: 8.5268

>NTDB_id=160399 SA40TW_RS07840 WP_000472256.1 1565905..1566216(-) (comGC) [Staphylococcus aureus strain SA40TW]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN

Nucleotide

• Length: 312 bp

>NTDB_id=160399 SA40TW_RS07840 WP_000472256.1 1565905..1566216(-) (comGC) [Staphylococcus aureus strain SA40TW]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	100	100	1
comGC	Staphylococcus aureus N315	100	100	1
comGC/cglC	Streptococcus pneumoniae TIGR4	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae Rx1	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae D39	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae R6	46.078	99.029	0.456
comGC/cglC	Streptococcus mitis SK321	51.163	83.495	0.427
comGC/cglC	Streptococcus mitis NCTC 12261	51.163	83.495	0.427
comYC	Streptococcus gordonii str. Challis substr. CH1	42.857	95.146	0.408
comYC	Streptococcus suis isolate S10	50	75.728	0.379
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	88.35	0.369
comGC	Lactococcus lactis subsp. cremoris KW2	46.341	79.612	0.369