Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   AAV34_RS04755 Genome accession   NZ_CP011937
Coordinates   932620..932760 (+) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain CBMB205     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 927620..937760
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AAV34_RS04725 (AAV34_04650) - 927923..928321 (+) 399 WP_003152031.1 YueI family protein -
  AAV34_RS04730 (AAV34_04655) - 928418..928969 (+) 552 WP_003152033.1 cysteine hydrolase family protein -
  AAV34_RS04735 (AAV34_04660) - 928987..930453 (+) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  AAV34_RS04740 (AAV34_04665) - 930583..931806 (+) 1224 WP_032876792.1 EAL and HDOD domain-containing protein -
  AAV34_RS04745 (AAV34_04670) - 931813..932154 (-) 342 WP_032876795.1 hypothetical protein -
  AAV34_RS04755 (AAV34_04680) degQ 932620..932760 (+) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  AAV34_RS04760 (AAV34_04685) - 932968..933828 (+) 861 WP_142925231.1 polyprenyl synthetase family protein -
  AAV34_RS04765 comX 933797..933970 (+) 174 WP_012118314.1 competence pheromone ComX -
  AAV34_RS04770 (AAV34_04690) comP 933984..936284 (+) 2301 WP_032876801.1 histidine kinase Regulator
  AAV34_RS04775 (AAV34_04695) comA 936365..937009 (+) 645 WP_003152052.1 response regulator transcription factor Regulator
  AAV34_RS04780 (AAV34_04700) - 937031..937414 (+) 384 WP_007613430.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=149407 AAV34_RS04755 WP_003152043.1 932620..932760(+) (degQ) [Bacillus velezensis strain CBMB205]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=149407 AAV34_RS04755 WP_003152043.1 932620..932760(+) (degQ) [Bacillus velezensis strain CBMB205]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment