Detailed information    

insolico Bioinformatically predicted

Overview


Name   abrB   Type   Regulator
Locus tag   WR47_RS13050 Genome accession   NZ_CP011151
Coordinates   2663397..2663675 (+) Length   92 a.a.
NCBI ID   WP_063547383.1    Uniprot ID   -
Organism   Bacillus cereus strain CMCC P0021     
Function   repression of comK; repression of rok (predicted from homology)   
Competence regulation

Genomic Context


Location: 2658397..2668675
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WR47_RS32570 - 2658927..2659076 (+) 150 WP_080469931.1 hypothetical protein -
  WR47_RS33230 - 2659195..2659323 (+) 129 WP_255288311.1 hypothetical protein -
  WR47_RS13010 (WR47_13360) - 2659339..2659707 (-) 369 WP_063547379.1 helix-turn-helix domain-containing protein -
  WR47_RS13015 (WR47_13365) - 2659951..2660160 (+) 210 WP_063547380.1 helix-turn-helix transcriptional regulator -
  WR47_RS13020 (WR47_13370) - 2660230..2660496 (+) 267 WP_000522020.1 helix-turn-helix domain-containing protein -
  WR47_RS32575 (WR47_13375) - 2660496..2660660 (+) 165 WP_080469807.1 hypothetical protein -
  WR47_RS32580 (WR47_13380) - 2660690..2660866 (+) 177 WP_080469808.1 hypothetical protein -
  WR47_RS13025 (WR47_13385) - 2660871..2661614 (+) 744 WP_063547381.1 DnaD domain protein -
  WR47_RS13030 (WR47_13390) - 2661583..2662386 (+) 804 WP_063547382.1 ATP-binding protein -
  WR47_RS13035 (WR47_13395) - 2662401..2662595 (+) 195 WP_000332458.1 hypothetical protein -
  WR47_RS13040 (WR47_13400) - 2662612..2663022 (+) 411 WP_000792379.1 hypothetical protein -
  WR47_RS13045 (WR47_13405) - 2663055..2663309 (-) 255 WP_000312979.1 hypothetical protein -
  WR47_RS13050 (WR47_13410) abrB 2663397..2663675 (+) 279 WP_063547383.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Regulator
  WR47_RS13055 (WR47_13415) - 2663668..2664027 (+) 360 WP_063547384.1 hypothetical protein -
  WR47_RS30860 (WR47_13420) - 2664046..2664213 (+) 168 WP_000717826.1 DUF3954 domain-containing protein -
  WR47_RS13060 (WR47_13425) - 2664239..2664490 (+) 252 WP_063547385.1 hypothetical protein -
  WR47_RS13065 (WR47_13430) - 2664510..2664965 (+) 456 WP_063547386.1 nucleoside triphosphate pyrophosphohydrolase family protein -
  WR47_RS13070 (WR47_13435) - 2665127..2665381 (+) 255 WP_050822240.1 hypothetical protein -
  WR47_RS13075 (WR47_13440) - 2665492..2666091 (-) 600 WP_063547387.1 undecaprenyl-diphosphatase -
  WR47_RS13080 (WR47_13445) - 2666631..2668013 (-) 1383 WP_063547388.1 BclA C-terminal domain-containing protein -
  WR47_RS13085 (WR47_13450) - 2668297..2668617 (+) 321 WP_063547389.1 hypothetical protein -

Sequence


Protein


Download         Length: 92 a.a.        Molecular weight: 10139.78 Da        Isoelectric Point: 5.1546

>NTDB_id=142889 WR47_RS13050 WP_063547383.1 2663397..2663675(+) (abrB) [Bacillus cereus strain CMCC P0021]
MKNTGVARKVDELGRVVIPVELRRTLGIVEGTALDFHVDGENIVLRKYEKSCFVTGEVSETNIELLGGRMFLSKEGAIEL
LDLIQKSGMAYA

Nucleotide


Download         Length: 279 bp        

>NTDB_id=142889 WR47_RS13050 WP_063547383.1 2663397..2663675(+) (abrB) [Bacillus cereus strain CMCC P0021]
ATGAAAAATACAGGTGTTGCAAGAAAAGTGGACGAGCTAGGTCGTGTAGTAATTCCAGTAGAGTTACGCAGAACTTTAGG
GATTGTCGAAGGTACGGCACTAGATTTTCATGTCGATGGGGAAAACATTGTTCTAAGAAAATATGAAAAGTCATGCTTTG
TAACGGGTGAAGTTTCTGAAACCAACATAGAGTTGCTAGGTGGCCGAATGTTTTTAAGCAAGGAAGGGGCAATTGAATTA
CTGGATCTTATTCAGAAGAGTGGGATGGCATATGCCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  abrB Bacillus subtilis subsp. subtilis str. 168

60.92

94.565

0.576


Multiple sequence alignment