Detailed information
Bioinformatically predicted
Overview
| Name | abrB | Type | Regulator |
| Locus tag | WR47_RS11745 | Genome accession | NZ_CP011151 |
| Coordinates | 2354344..2354622 (+) | Length | 92 a.a. |
| NCBI ID | WP_063547228.1 | Uniprot ID | - |
| Organism | Bacillus cereus strain CMCC P0021 | ||
| Function | repression of comK; repression of rok (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2328177..2393831 | 2354344..2354622 | within | 0 |
Gene organization within MGE regions
Location: 2328177..2393831
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| WR47_RS11600 (WR47_11900) | - | 2328177..2328725 (-) | 549 | WP_063547208.1 | hypothetical protein | - |
| WR47_RS11605 (WR47_11905) | - | 2329036..2329587 (+) | 552 | WP_053564527.1 | GNAT family N-acetyltransferase | - |
| WR47_RS11610 (WR47_11910) | - | 2329633..2329818 (-) | 186 | WP_000286203.1 | cold-shock protein | - |
| WR47_RS11615 (WR47_11915) | cspD | 2329905..2330108 (-) | 204 | WP_000176366.1 | cold-shock protein CspD | - |
| WR47_RS11620 (WR47_11920) | - | 2330491..2331387 (+) | 897 | WP_063547209.1 | CPBP family intramembrane glutamic endopeptidase | - |
| WR47_RS11625 (WR47_11925) | - | 2331387..2332046 (+) | 660 | WP_142338410.1 | AAA family ATPase | - |
| WR47_RS11630 (WR47_11930) | - | 2332304..2332909 (+) | 606 | WP_063547211.1 | PRK06770 family protein | - |
| WR47_RS11635 (WR47_11935) | - | 2332980..2333846 (-) | 867 | WP_063547212.1 | LysR family transcriptional regulator | - |
| WR47_RS11640 (WR47_11940) | - | 2333976..2335019 (+) | 1044 | WP_063547213.1 | aspartate-semialdehyde dehydrogenase | - |
| WR47_RS11645 (WR47_11945) | - | 2335098..2335529 (-) | 432 | WP_063547214.1 | hypothetical protein | - |
| WR47_RS11650 (WR47_11950) | - | 2335816..2336940 (+) | 1125 | WP_063547215.1 | C45 family autoproteolytic acyltransferase/hydolase | - |
| WR47_RS11655 (WR47_11955) | - | 2336992..2337255 (+) | 264 | WP_063549298.1 | hypothetical protein | - |
| WR47_RS11660 (WR47_11960) | - | 2337352..2338254 (-) | 903 | WP_063547216.1 | LysR family transcriptional regulator | - |
| WR47_RS11665 (WR47_11965) | - | 2338411..2339100 (+) | 690 | WP_063547217.1 | MOSC domain-containing protein | - |
| WR47_RS11670 (WR47_11970) | - | 2339359..2340246 (+) | 888 | WP_063547218.1 | GNAT family N-acetyltransferase | - |
| WR47_RS11675 (WR47_11975) | - | 2340280..2340876 (+) | 597 | WP_063547219.1 | DUF1349 domain-containing protein | - |
| WR47_RS11680 (WR47_11980) | - | 2341098..2342852 (+) | 1755 | WP_063547220.1 | ABC transporter ATP-binding protein | - |
| WR47_RS11685 (WR47_11985) | - | 2342845..2344641 (+) | 1797 | WP_063547221.1 | ABC transporter ATP-binding protein | - |
| WR47_RS11690 (WR47_11995) | exsF | 2345276..2345779 (-) | 504 | WP_063547222.1 | exosporium protein ExsF | - |
| WR47_RS11695 (WR47_12000) | - | 2346165..2346449 (-) | 285 | WP_001123247.1 | DUF4183 domain-containing protein | - |
| WR47_RS11700 (WR47_12005) | - | 2346842..2347948 (-) | 1107 | WP_063547223.1 | site-specific integrase | - |
| WR47_RS32525 (WR47_12010) | - | 2348153..2348308 (+) | 156 | WP_196213901.1 | hypothetical protein | - |
| WR47_RS11705 (WR47_12015) | - | 2348435..2348788 (-) | 354 | WP_048558286.1 | helix-turn-helix domain-containing protein | - |
| WR47_RS11710 (WR47_12020) | - | 2349287..2350429 (+) | 1143 | WP_063547224.1 | AimR family lysis-lysogeny pheromone receptor | - |
| WR47_RS32165 | - | 2350462..2350614 (+) | 153 | WP_154400985.1 | hypothetical protein | - |
| WR47_RS33215 | - | 2350744..2350866 (+) | 123 | WP_255259040.1 | hypothetical protein | - |
| WR47_RS11715 (WR47_12025) | - | 2350880..2351224 (-) | 345 | WP_048558219.1 | helix-turn-helix domain-containing protein | - |
| WR47_RS11720 (WR47_12030) | - | 2351452..2351691 (+) | 240 | WP_063547225.1 | helix-turn-helix domain-containing protein | - |
| WR47_RS11725 (WR47_12035) | - | 2351773..2352039 (+) | 267 | WP_059303819.1 | helix-turn-helix domain-containing protein | - |
| WR47_RS32530 (WR47_12040) | - | 2352039..2352203 (+) | 165 | WP_033693158.1 | hypothetical protein | - |
| WR47_RS32535 (WR47_12045) | - | 2352233..2352409 (+) | 177 | WP_080469789.1 | hypothetical protein | - |
| WR47_RS11730 (WR47_12050) | - | 2352416..2353303 (+) | 888 | WP_063547226.1 | DnaD domain-containing protein | - |
| WR47_RS11735 (WR47_12055) | - | 2353242..2354117 (+) | 876 | WP_080469790.1 | ATP-binding protein | - |
| WR47_RS11740 (WR47_12060) | - | 2354133..2354327 (+) | 195 | WP_063547227.1 | hypothetical protein | - |
| WR47_RS11745 (WR47_12065) | abrB | 2354344..2354622 (+) | 279 | WP_063547228.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Regulator |
| WR47_RS11750 (WR47_12070) | - | 2354615..2354974 (+) | 360 | WP_063547229.1 | hypothetical protein | - |
| WR47_RS30680 (WR47_12075) | - | 2354994..2355161 (+) | 168 | WP_000717826.1 | DUF3954 domain-containing protein | - |
| WR47_RS11755 (WR47_12080) | - | 2355187..2355438 (+) | 252 | WP_000109496.1 | hypothetical protein | - |
| WR47_RS11760 (WR47_12085) | - | 2355458..2355913 (+) | 456 | WP_063547230.1 | nucleoside triphosphate pyrophosphohydrolase family protein | - |
| WR47_RS11765 (WR47_12090) | - | 2356583..2357290 (-) | 708 | WP_063547231.1 | hypothetical protein | - |
| WR47_RS32170 | - | 2357342..2357515 (+) | 174 | WP_154816431.1 | hypothetical protein | - |
| WR47_RS32540 (WR47_12095) | - | 2357655..2357825 (+) | 171 | WP_080469791.1 | hypothetical protein | - |
| WR47_RS11770 (WR47_12100) | - | 2357853..2358335 (+) | 483 | WP_063547232.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| WR47_RS11775 (WR47_12105) | - | 2358335..2358877 (+) | 543 | WP_063547233.1 | site-specific integrase | - |
| WR47_RS11780 (WR47_12110) | - | 2359032..2360540 (+) | 1509 | WP_063547234.1 | PIN domain-containing protein | - |
| WR47_RS11785 (WR47_12115) | - | 2360860..2361153 (+) | 294 | WP_063547235.1 | hypothetical protein | - |
| WR47_RS11795 (WR47_12125) | - | 2361602..2362021 (-) | 420 | WP_063547237.1 | hypothetical protein | - |
| WR47_RS33220 (WR47_12130) | - | 2362188..2362550 (+) | 363 | WP_268865620.1 | HNH endonuclease | - |
| WR47_RS11805 (WR47_12135) | - | 2362699..2363157 (-) | 459 | WP_063547239.1 | hypothetical protein | - |
| WR47_RS11810 (WR47_12140) | - | 2363255..2363776 (+) | 522 | WP_063547240.1 | phage terminase small subunit P27 family | - |
| WR47_RS11815 (WR47_12145) | - | 2363785..2365500 (+) | 1716 | WP_063547241.1 | terminase large subunit | - |
| WR47_RS11820 (WR47_12150) | - | 2365514..2366755 (+) | 1242 | WP_063547242.1 | phage portal protein | - |
| WR47_RS11825 (WR47_12155) | - | 2366730..2367428 (+) | 699 | WP_002134054.1 | head maturation protease, ClpP-related | - |
| WR47_RS11830 (WR47_12160) | - | 2367466..2368638 (+) | 1173 | WP_063547243.1 | phage major capsid protein | - |
| WR47_RS11835 (WR47_12165) | - | 2368673..2368966 (+) | 294 | WP_063547244.1 | head-tail connector protein | - |
| WR47_RS11840 (WR47_12170) | - | 2368963..2369307 (+) | 345 | WP_001068032.1 | phage head closure protein | - |
| WR47_RS11845 (WR47_12175) | - | 2369295..2369732 (+) | 438 | WP_063547245.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| WR47_RS11850 (WR47_12180) | - | 2369729..2370091 (+) | 363 | WP_063547246.1 | DUF3168 domain-containing protein | - |
| WR47_RS11855 (WR47_12185) | - | 2370107..2370691 (+) | 585 | WP_063547247.1 | major tail protein | - |
| WR47_RS11860 (WR47_12190) | gpG | 2370748..2371122 (+) | 375 | WP_015382157.1 | phage tail assembly chaperone G | - |
| WR47_RS11865 (WR47_12195) | - | 2371287..2376284 (+) | 4998 | WP_063547248.1 | phage tail tape measure protein | - |
| WR47_RS11870 (WR47_12200) | - | 2376324..2377781 (+) | 1458 | WP_063547249.1 | distal tail protein Dit | - |
| WR47_RS11875 (WR47_12205) | - | 2377778..2382136 (+) | 4359 | WP_063547250.1 | phage tail spike protein | - |
| WR47_RS11880 (WR47_12210) | - | 2382148..2382528 (+) | 381 | WP_063547251.1 | hypothetical protein | - |
| WR47_RS11885 (WR47_12215) | - | 2382624..2382860 (+) | 237 | Protein_2316 | hemolysin XhlA family protein | - |
| WR47_RS11890 (WR47_12220) | - | 2382860..2383099 (+) | 240 | WP_000461725.1 | hypothetical protein | - |
| WR47_RS11895 (WR47_12225) | - | 2383096..2384160 (+) | 1065 | WP_063547252.1 | N-acetylmuramoyl-L-alanine amidase | - |
| WR47_RS11900 (WR47_12230) | - | 2384383..2386467 (+) | 2085 | WP_063547253.1 | P-loop NTPase fold protein | - |
| WR47_RS11905 (WR47_12235) | - | 2386575..2386787 (-) | 213 | WP_063547254.1 | hypothetical protein | - |
| WR47_RS11910 (WR47_12240) | - | 2387080..2387316 (-) | 237 | WP_000774113.1 | hypothetical protein | - |
| WR47_RS11915 (WR47_12245) | - | 2387703..2388485 (-) | 783 | WP_053564517.1 | glycosyltransferase family 2 protein | - |
| WR47_RS11920 (WR47_12250) | - | 2388665..2389249 (-) | 585 | WP_001121273.1 | LysE family transporter | - |
| WR47_RS11925 (WR47_12255) | - | 2389305..2389919 (+) | 615 | WP_130813712.1 | helix-turn-helix domain-containing protein | - |
| WR47_RS11935 (WR47_12265) | - | 2390286..2390909 (-) | 624 | WP_063547255.1 | BclA C-terminal domain-containing protein | - |
| WR47_RS11940 (WR47_12270) | - | 2391126..2391956 (+) | 831 | WP_063547256.1 | DUF4183 domain-containing protein | - |
| WR47_RS11945 (WR47_12275) | - | 2392518..2393831 (+) | 1314 | WP_063547257.1 | exosporium glycoprotein BclB-related protein | - |
Sequence
Protein
Download Length: 92 a.a. Molecular weight: 9941.41 Da Isoelectric Point: 5.1665
>NTDB_id=142887 WR47_RS11745 WP_063547228.1 2354344..2354622(+) (abrB) [Bacillus cereus strain CMCC P0021]
MKNTGVARKVDELGRVVIPIELRRTLGIAEGTALGFHVEGENIVLRKQDKSCFVTGEVSESNIELLDGRMFLSKEGASEL
LGVIEKSGNVNA
MKNTGVARKVDELGRVVIPIELRRTLGIAEGTALGFHVEGENIVLRKQDKSCFVTGEVSESNIELLDGRMFLSKEGASEL
LGVIEKSGNVNA
Nucleotide
Download Length: 279 bp
>NTDB_id=142887 WR47_RS11745 WP_063547228.1 2354344..2354622(+) (abrB) [Bacillus cereus strain CMCC P0021]
ATGAAAAACACAGGTGTTGCAAGAAAAGTGGACGAGCTAGGGCGTGTGGTAATTCCAATAGAGTTACGCAGAACTTTAGG
GATTGCTGAAGGTACAGCATTAGGCTTTCATGTTGAAGGAGAAAACATCGTTTTAAGAAAACAGGATAAGTCGTGCTTTG
TAACGGGTGAAGTTTCTGAATCAAACATAGAGTTGCTAGATGGTCGGATGTTTTTAAGCAAGGAAGGTGCAAGTGAGTTG
CTAGGCGTTATTGAGAAGAGTGGGAATGTAAATGCCTAA
ATGAAAAACACAGGTGTTGCAAGAAAAGTGGACGAGCTAGGGCGTGTGGTAATTCCAATAGAGTTACGCAGAACTTTAGG
GATTGCTGAAGGTACAGCATTAGGCTTTCATGTTGAAGGAGAAAACATCGTTTTAAGAAAACAGGATAAGTCGTGCTTTG
TAACGGGTGAAGTTTCTGAATCAAACATAGAGTTGCTAGATGGTCGGATGTTTTTAAGCAAGGAAGGTGCAAGTGAGTTG
CTAGGCGTTATTGAGAAGAGTGGGAATGTAAATGCCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| abrB | Bacillus subtilis subsp. subtilis str. 168 |
58.621 |
94.565 |
0.554 |