Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   HSISS4_RS09055 Genome accession   NZ_CP013216
Coordinates   1962911..1963141 (-) Length   76 a.a.
NCBI ID   WP_021144685.1    Uniprot ID   -
Organism   Streptococcus salivarius strain HSISS4     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1957911..1968141
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HSISS4_RS09020 (HSISS4_01756) - 1958301..1958747 (-) 447 WP_021144682.1 hypothetical protein -
  HSISS4_RS09025 (HSISS4_01757) - 1958825..1959481 (-) 657 WP_002887011.1 CPBP family intramembrane glutamic endopeptidase -
  HSISS4_RS09030 (HSISS4_01758) - 1959493..1959690 (-) 198 WP_002885716.1 helix-turn-helix transcriptional regulator -
  HSISS4_RS09035 (HSISS4_01759) - 1959941..1961134 (-) 1194 WP_002885831.1 acetate kinase -
  HSISS4_RS09040 (HSISS4_01760) comGH 1961191..1962147 (-) 957 WP_002885753.1 class I SAM-dependent methyltransferase Machinery gene
  HSISS4_RS09045 (HSISS4_01761) comGG 1962192..1962509 (-) 318 WP_021144683.1 competence type IV pilus minor pilin ComGG Machinery gene
  HSISS4_RS09050 (HSISS4_01762) comGF 1962487..1962924 (-) 438 WP_021144684.1 competence type IV pilus minor pilin ComGF Machinery gene
  HSISS4_RS09055 (HSISS4_01763) comGE 1962911..1963141 (-) 231 WP_021144685.1 competence type IV pilus minor pilin ComGE Machinery gene
  HSISS4_RS09060 (HSISS4_01764) comGD 1963173..1963601 (-) 429 WP_253183813.1 competence type IV pilus minor pilin ComGD Machinery gene
  HSISS4_RS09065 (HSISS4_01765) comGC 1963561..1963887 (-) 327 WP_002885815.1 competence type IV pilus major pilin ComGC Machinery gene
  HSISS4_RS09070 (HSISS4_01766) comGB 1963884..1964984 (-) 1101 WP_144429890.1 competence type IV pilus assembly protein ComGB Machinery gene
  HSISS4_RS09075 (HSISS4_01767) comGA 1964866..1965807 (-) 942 WP_002885658.1 competence type IV pilus ATPase ComGA Machinery gene
  HSISS4_RS09080 (HSISS4_01768) - 1965889..1966251 (-) 363 WP_021144688.1 DUF1033 family protein -

Sequence


Protein


Download         Length: 76 a.a.        Molecular weight: 8413.85 Da        Isoelectric Point: 10.4655

>NTDB_id=139536 HSISS4_RS09055 WP_021144685.1 1962911..1963141(-) (comGE) [Streptococcus salivarius strain HSISS4]
MAVLVLVSGLILEQINTNRRLMARNLHQQEVLSVATMAVQTKQDQLTLNGITVTVKRSKQGIAVYESGKEIIHVSQ

Nucleotide


Download         Length: 231 bp        

>NTDB_id=139536 HSISS4_RS09055 WP_021144685.1 1962911..1963141(-) (comGE) [Streptococcus salivarius strain HSISS4]
ATGGCTGTTTTAGTACTTGTCAGTGGTCTTATTTTGGAACAAATCAATACCAATCGTAGGCTAATGGCTAGGAATCTCCA
CCAACAGGAGGTCTTGAGTGTGGCAACCATGGCAGTTCAGACCAAACAGGATCAGTTGACCTTAAATGGCATCACAGTGA
CAGTTAAACGTAGCAAGCAAGGTATCGCGGTTTATGAATCAGGAAAGGAGATTATTCATGTCTCTCAATAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Streptococcus mutans UA140

37.838

97.368

0.368

  comGE Streptococcus mutans UA159

37.838

97.368

0.368


Multiple sequence alignment