Detailed information    

insolico Bioinformatically predicted

Overview

Name   pilX   Type   Machinery gene
Locus tag   LA50_RS01555 Genome accession   NZ_CP009418
Coordinates   258973..259446 (-) Length   157 a.a.
NCBI ID   WP_002248276.1    Uniprot ID   -
Organism   Neisseria meningitidis strain NM3686     
Function   assembly of type IV pilus (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 197197..269871 258973..259446 within 0


Gene organization within MGE regions


Location: 197197..269871
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LA50_RS01190 (LA50_01240) tadA 197197..197916 (+) 720 WP_002221136.1 tRNA adenosine(34) deaminase TadA -
  LA50_RS01195 (LA50_01245) - 197921..198409 (+) 489 WP_002219411.1 DUF456 domain-containing protein -
  LA50_RS01200 (LA50_01250) rlmB 198475..199227 (+) 753 WP_041422990.1 23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB -
  LA50_RS01205 (LA50_01255) - 199289..200680 (-) 1392 WP_002223860.1 nucleobase:cation symporter-2 family protein -
  LA50_RS01210 (LA50_01260) dapA 201141..202016 (+) 876 WP_002223861.1 4-hydroxy-tetrahydrodipicolinate synthase -
  LA50_RS01215 (LA50_01265) bamC 202025..203221 (+) 1197 WP_002219415.1 outer membrane protein assembly factor BamC -
  LA50_RS01220 (LA50_01270) pip 203278..204210 (-) 933 WP_002234609.1 prolyl aminopeptidase -
  LA50_RS01230 (LA50_01280) - 204856..205821 (+) 966 WP_002216744.1 IS30-like element IS1655 family transposase -
  LA50_RS01235 (LA50_01285) - 206591..207376 (+) 786 WP_079870540.1 opacity family porin -
  LA50_RS01240 (LA50_01290) yciA 208520..208966 (+) 447 WP_002220759.1 acyl-CoA thioester hydrolase YciA -
  LA50_RS01245 (LA50_01295) - 209017..209838 (-) 822 WP_002220757.1 SDR family oxidoreductase -
  LA50_RS01250 (LA50_01300) - 209957..210415 (+) 459 WP_002220755.1 c-type cytochrome -
  LA50_RS01255 (LA50_01305) lst 210580..211695 (-) 1116 WP_002224441.1 N-acetyllactosaminide alpha-2,3-sialyltransferase -
  LA50_RS14280 - 211898..212068 (-) 171 WP_009345138.1 hypothetical protein -
  LA50_RS01260 (LA50_01315) - 212128..214353 (+) 2226 WP_002220751.1 NADP-dependent isocitrate dehydrogenase -
  LA50_RS13635 - 215521..215655 (+) 135 Protein_239 IS110 family transposase -
  LA50_RS01270 (LA50_01330) - 215719..216726 (+) 1008 Protein_240 IS5 family transposase -
  LA50_RS01275 (LA50_01335) - 216864..217832 (+) 969 Protein_241 IS5 family transposase -
  LA50_RS14840 (LA50_01340) - 218248..218379 (+) 132 WP_002217434.1 hypothetical protein -
  LA50_RS01285 (LA50_01345) - 218376..218744 (+) 369 WP_002220735.1 type II toxin-antitoxin system death-on-curing family toxin -
  LA50_RS14285 - 218760..218930 (+) 171 WP_164728559.1 hypothetical protein -
  LA50_RS01290 (LA50_01355) - 219035..219673 (+) 639 WP_002244527.1 DUF4760 domain-containing protein -
  LA50_RS01295 (LA50_01365) - 220032..220268 (+) 237 WP_002217439.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
  LA50_RS01300 (LA50_01370) - 220270..220617 (+) 348 WP_002217440.1 type II toxin-antitoxin system PemK/MazF family toxin -
  LA50_RS01305 (LA50_01375) - 220670..221179 (-) 510 WP_002220734.1 hypothetical protein -
  LA50_RS01310 (LA50_01380) - 221191..221664 (-) 474 WP_002220733.1 D-Ala-D-Ala carboxypeptidase family metallohydrolase -
  LA50_RS01315 (LA50_01385) - 221803..222078 (-) 276 WP_002217443.1 hypothetical protein -
  LA50_RS01320 (LA50_01390) - 222075..222500 (-) 426 WP_002220721.1 hypothetical protein -
  LA50_RS01325 (LA50_01395) - 222564..222935 (-) 372 WP_002220720.1 hypothetical protein -
  LA50_RS14950 (LA50_01400) - 223003..223209 (-) 207 WP_002217448.1 hypothetical protein -
  LA50_RS01335 (LA50_01405) - 223226..223672 (-) 447 WP_002220718.1 hypothetical protein -
  LA50_RS01340 (LA50_01410) - 223743..228008 (-) 4266 WP_002220717.1 phage tail protein -
  LA50_RS01345 (LA50_01420) - 228144..228866 (-) 723 WP_002220716.1 tail assembly protein -
  LA50_RS01350 (LA50_01425) - 228863..229618 (-) 756 WP_002244525.1 C40 family peptidase -
  LA50_RS01355 (LA50_01430) - 229615..230337 (-) 723 WP_002217456.1 phage minor tail protein L -
  LA50_RS01360 (LA50_01435) - 230397..230666 (-) 270 WP_002217457.1 phage tail protein -
  LA50_RS01365 (LA50_01440) - 230688..233906 (-) 3219 WP_002224445.1 phage tail length tape measure family protein -
  LA50_RS01370 (LA50_01445) - 233899..234171 (-) 273 WP_002220710.1 DUF1799 domain-containing protein -
  LA50_RS01375 (LA50_01450) - 234219..234530 (-) 312 WP_002220709.1 phage tail assembly chaperone -
  LA50_RS01380 (LA50_01455) - 234594..235235 (-) 642 WP_002220708.1 phage tail protein -
  LA50_RS01385 (LA50_01460) - 235267..235686 (-) 420 WP_002244524.1 hypothetical protein -
  LA50_RS01390 (LA50_01465) - 235667..235969 (-) 303 WP_002244523.1 hypothetical protein -
  LA50_RS01395 (LA50_01470) - 235962..236189 (-) 228 WP_002220705.1 hypothetical protein -
  LA50_RS01400 (LA50_01475) - 236247..238139 (-) 1893 WP_002220704.1 phage major capsid protein -
  LA50_RS01405 (LA50_01480) - 238120..239682 (-) 1563 WP_002220703.1 phage portal protein -
  LA50_RS01410 (LA50_01485) - 239691..239945 (-) 255 WP_002220702.1 hypothetical protein -
  LA50_RS01415 (LA50_01490) - 239932..240318 (-) 387 WP_002220701.1 DUF3310 domain-containing protein -
  LA50_RS01420 (LA50_01495) - 240321..240530 (-) 210 WP_002220700.1 hypothetical protein -
  LA50_RS01425 (LA50_01500) - 240547..243393 (-) 2847 WP_002220699.1 primase-helicase family protein -
  LA50_RS01430 (LA50_01505) - 243508..243855 (-) 348 WP_002220698.1 hypothetical protein -
  LA50_RS01435 (LA50_01510) - 244255..244971 (+) 717 WP_002220696.1 S24 family peptidase -
  LA50_RS01440 (LA50_01515) - 245074..245499 (+) 426 WP_002220695.1 hypothetical protein -
  LA50_RS01445 (LA50_01520) - 245730..245930 (+) 201 WP_002219431.1 hypothetical protein -
  LA50_RS01450 (LA50_01525) - 245998..246357 (+) 360 WP_002220694.1 hypothetical protein -
  LA50_RS01455 (LA50_01530) - 246382..247236 (+) 855 WP_002220693.1 YfdQ family protein -
  LA50_RS01460 (LA50_01535) - 247308..247523 (+) 216 WP_002220692.1 hypothetical protein -
  LA50_RS01465 (LA50_01540) - 247559..247819 (+) 261 WP_002220690.1 NGO1622 family putative holin -
  LA50_RS01470 (LA50_01545) - 247816..248109 (+) 294 WP_002220689.1 hypothetical protein -
  LA50_RS01475 (LA50_01550) - 248112..248303 (+) 192 WP_002219435.1 type ISP restriction/modification enzyme -
  LA50_RS01480 (LA50_01555) - 248303..248443 (+) 141 WP_002220688.1 hypothetical protein -
  LA50_RS01485 (LA50_01560) - 248440..248649 (+) 210 WP_002220687.1 hypothetical protein -
  LA50_RS01490 (LA50_01565) - 248707..249624 (-) 918 WP_002220686.1 KilA-N domain-containing protein -
  LA50_RS01495 (LA50_01575) - 250492..250971 (-) 480 WP_002241413.1 DUF4760 domain-containing protein -
  LA50_RS01510 (LA50_01590) - 251407..251787 (-) 381 WP_002220683.1 type II toxin-antitoxin system PemK/MazF family toxin -
  LA50_RS01515 (LA50_01600) - 251942..253138 (-) 1197 WP_002224447.1 tyrosine-type recombinase/integrase -
  LA50_RS01530 (LA50_01615) yaaA 253670..254449 (-) 780 WP_002220681.1 peroxide stress protein YaaA -
  LA50_RS15045 - 254498..254623 (-) 126 Protein_290 IS5/IS1182 family transposase -
  LA50_RS01535 (LA50_01620) dapC 254711..255898 (-) 1188 WP_002220680.1 succinyldiaminopimelate transaminase -
  LA50_RS01540 (LA50_01625) dut 255974..256426 (-) 453 WP_002220679.1 dUTP diphosphatase -
  LA50_RS01545 (LA50_01630) - 256569..256997 (+) 429 Protein_293 AzlC family ABC transporter permease -
  LA50_RS01555 (LA50_01635) pilX 258973..259446 (-) 474 WP_002248276.1 PilX family type IV pilin Machinery gene
  LA50_RS01560 (LA50_01640) pilK 259451..260050 (-) 600 WP_002248501.1 PilX N-terminal domain-containing pilus assembly protein Machinery gene
  LA50_RS01565 (LA50_01645) pilJ 260029..260967 (-) 939 WP_002248500.1 PilW family protein Machinery gene
  LA50_RS01570 (LA50_01650) pilV 260964..261578 (-) 615 WP_002248499.1 type IV pilus modification protein PilV Machinery gene
  LA50_RS01575 (LA50_01655) pilH 261602..262279 (-) 678 WP_002213841.1 Tfp pilus assembly protein FimT/FimU Machinery gene
  LA50_RS01580 (LA50_01660) dnaB 262588..263994 (-) 1407 WP_002248498.1 replicative DNA helicase -
  LA50_RS01585 (LA50_01665) - 264157..264744 (+) 588 WP_002248497.1 superoxide dismutase -
  LA50_RS01590 (LA50_01670) - 265390..265899 (-) 510 WP_002213852.1 isoprenylcysteine carboxyl methyltransferase family protein -
  LA50_RS01595 (LA50_01675) - 266231..266563 (-) 333 WP_002226445.1 hypothetical protein -
  LA50_RS01600 (LA50_01680) cysT 266853..267689 (+) 837 WP_002217475.1 sulfate ABC transporter permease subunit CysT -
  LA50_RS01605 (LA50_01685) cysW 267941..268801 (+) 861 WP_002220668.1 sulfate ABC transporter permease subunit CysW -
  LA50_RS01610 (LA50_01690) - 268798..269871 (+) 1074 WP_002229312.1 sulfate/molybdate ABC transporter ATP-binding protein -

Sequence

Protein


Download         Length: 157 a.a.        Molecular weight: 17528.29 Da        Isoelectric Point: 9.4344

>NTDB_id=128976 LA50_RS01555 WP_002248276.1 258973..259446(-) (pilX) [Neisseria meningitidis strain NM3686]
MEQKGFTLIEMMIVVAILGIISVIAIPSYQSYIEKGYQSQLYTEMVGINNISKQFILKNPLDDNQTIKSKLEIFVSGYKM
NPKIAEKYNVSVHFVNKEKPRAYSLVGVPKTGTGYTLSVWMNSVGDGYKCRDAASARAHLETLSSDVGCEAFSNRKK

Nucleotide


Download         Length: 474 bp        

>NTDB_id=128976 LA50_RS01555 WP_002248276.1 258973..259446(-) (pilX) [Neisseria meningitidis strain NM3686]
ATGGAACAAAAAGGGTTTACATTGATTGAGATGATGATAGTCGTCGCGATACTCGGCATCATCAGCGTCATTGCCATACC
TTCTTATCAAAGTTATATTGAAAAAGGCTATCAGTCCCAGCTTTATACGGAGATGGTCGGTATCAACAATATTTCCAAAC
AGTTTATTTTGAAAAATCCCCTGGACGATAATCAGACCATCAAGAGCAAACTGGAAATATTTGTCTCAGGCTATAAGATG
AATCCGAAAATTGCCGAAAAATATAATGTTTCGGTGCATTTTGTCAATAAGGAAAAACCAAGGGCATACAGCTTGGTCGG
CGTTCCAAAGACGGGGACGGGTTATACTTTGTCGGTATGGATGAACAGCGTGGGCGACGGATACAAATGCCGTGATGCCG
CTTCTGCCCGAGCCCATTTGGAGACCTTGTCCTCAGATGTCGGCTGTGAAGCCTTCTCTAATCGTAAAAAATAG

Domains

Predicted by InterproScan.

Minor type IV pilin, PilX (Pilin_PilX)

(31-157)

Prokaryotic N-terminal methylation motif (N_methyl)

(3-25)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  pilX Neisseria meningitidis 8013

99.363

100

0.994
  pilL Neisseria gonorrhoeae MS11

86.624

100

0.866

Multiple sequence alignment