Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   CS886_RS00220 Genome accession   NZ_LT635478
Coordinates   40241..40354 (+) Length   37 a.a.
NCBI ID   WP_001217877.1    Uniprot ID   A0A1A9H2U2
Organism   Helicobacter pylori isolate HE142/09     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 35241..45354
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CS886_RS00195 - 35282..37510 (+) 2229 WP_089086473.1 AAA family ATPase -
  CS886_RS00200 panD 37500..37853 (+) 354 WP_000142286.1 aspartate 1-decarboxylase -
  CS886_RS00205 - 37856..38158 (+) 303 WP_000347926.1 YbaB/EbfC family nucleoid-associated protein -
  CS886_RS00210 - 38158..39162 (+) 1005 WP_089086474.1 PDZ domain-containing protein -
  CS886_RS00215 comB6 39170..40225 (+) 1056 WP_089086475.1 P-type conjugative transfer protein TrbL Machinery gene
  CS886_RS00220 comB7 40241..40354 (+) 114 WP_001217877.1 hypothetical protein Machinery gene
  CS886_RS00225 comB8 40351..41094 (+) 744 WP_000660557.1 type IV secretion system protein Machinery gene
  CS886_RS00230 comB9 41094..42080 (+) 987 WP_089086476.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  CS886_RS00235 comB10 42073..43209 (+) 1137 WP_089086477.1 DNA type IV secretion system protein ComB10 Machinery gene
  CS886_RS00240 - 43279..44691 (+) 1413 WP_089086478.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence

Protein


Download         Length: 37 a.a.        Molecular weight: 4291.23 Da        Isoelectric Point: 9.3572

>NTDB_id=1145884 CS886_RS00220 WP_001217877.1 40241..40354(+) (comB7) [Helicobacter pylori isolate HE142/09]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=1145884 CS886_RS00220 WP_001217877.1 40241..40354(+) (comB7) [Helicobacter pylori isolate HE142/09]
ATGAGAATTTTTTTTGTTATTATGGGACTTGTGTTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAGAAAAGCCCTTG
CACCTTGTATGAAAACAGGTTAAATCTCGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A1A9H2U2

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

97.297

100

0.973

Multiple sequence alignment