Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | DQM50_RS02155 | Genome accession | NZ_LS483347 |
| Coordinates | 389539..389721 (+) | Length | 60 a.a. |
| NCBI ID | WP_047149504.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain NCTC8324 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 329737..392776 | 389539..389721 | within | 0 |
Gene organization within MGE regions
Location: 329737..392776
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQM50_RS01820 (NCTC8324_00361) | - | 329737..330633 (-) | 897 | WP_021299026.1 | sulfite exporter TauE/SafE family protein | - |
| DQM50_RS01825 (NCTC8324_00362) | - | 330931..331683 (+) | 753 | WP_002983053.1 | CppA N-terminal domain-containing protein | - |
| DQM50_RS01830 (NCTC8324_00363) | - | 331668..332618 (+) | 951 | WP_011018196.1 | serine hydrolase domain-containing protein | - |
| DQM50_RS01835 (NCTC8324_00364) | pflB | 332798..335125 (-) | 2328 | WP_023610530.1 | formate C-acetyltransferase | - |
| DQM50_RS01840 (NCTC8324_00365) | dinB | 335334..336428 (+) | 1095 | WP_002983063.1 | DNA polymerase IV | - |
| DQM50_RS01845 (NCTC8324_00366) | - | 336521..337003 (-) | 483 | WP_002983066.1 | hypothetical protein | - |
| DQM50_RS01850 (NCTC8324_00367) | - | 337094..339547 (-) | 2454 | WP_085613805.1 | ATP-dependent RecD-like DNA helicase | - |
| DQM50_RS01855 (NCTC8324_00368) | lepB | 339605..340198 (-) | 594 | WP_002983074.1 | signal peptidase I | - |
| DQM50_RS01860 (NCTC8324_00369) | rnhC | 340209..341111 (-) | 903 | WP_010922635.1 | ribonuclease HIII | - |
| DQM50_RS01865 (NCTC8324_00370) | - | 341268..341576 (+) | 309 | WP_002993251.1 | hypothetical protein | - |
| DQM50_RS01870 (NCTC8324_00371) | - | 341579..342124 (+) | 546 | WP_002983087.1 | CvpA family protein | - |
| DQM50_RS01875 (NCTC8324_00372) | - | 342273..344612 (+) | 2340 | WP_085613804.1 | endonuclease MutS2 | - |
| DQM50_RS01880 (NCTC8324_00373) | - | 344616..345116 (+) | 501 | WP_087671310.1 | phosphatase PAP2 family protein | - |
| DQM50_RS01885 (NCTC8324_00374) | trxA | 345179..345511 (+) | 333 | WP_256363924.1 | thioredoxin | - |
| DQM50_RS01890 (NCTC8324_00375) | - | 345563..346150 (-) | 588 | WP_011018189.1 | helix-turn-helix domain-containing protein | - |
| DQM50_RS01895 (NCTC8324_00376) | mutY | 346327..347481 (-) | 1155 | WP_168393025.1 | A/G-specific adenine glycosylase | - |
| DQM50_RS01900 (NCTC8324_00377) | - | 347649..347942 (+) | 294 | WP_002983113.1 | hypothetical protein | - |
| DQM50_RS01905 (NCTC8324_00378) | rpsF | 348115..348405 (+) | 291 | WP_002983117.1 | 30S ribosomal protein S6 | - |
| DQM50_RS01910 (NCTC8324_00379) | ssb | 348427..348918 (+) | 492 | WP_002983122.1 | single-stranded DNA-binding protein | Machinery gene |
| DQM50_RS01915 (NCTC8324_00380) | rpsR | 349083..349322 (+) | 240 | WP_002983142.1 | 30S ribosomal protein S18 | - |
| DQM50_RS01920 (NCTC8324_00381) | - | 349455..350111 (-) | 657 | WP_002983144.1 | DUF1129 domain-containing protein | - |
| DQM50_RS01925 (NCTC8324_00382) | - | 350243..351187 (-) | 945 | WP_002983147.1 | magnesium transporter CorA family protein | - |
| DQM50_RS01930 (NCTC8324_00383) | - | 351431..352528 (-) | 1098 | WP_047149517.1 | site-specific integrase | - |
| DQM50_RS01935 (NCTC8324_00384) | - | 352704..353255 (-) | 552 | WP_047149516.1 | hypothetical protein | - |
| DQM50_RS01940 (NCTC8324_00385) | - | 353266..353649 (-) | 384 | WP_047149515.1 | ImmA/IrrE family metallo-endopeptidase | - |
| DQM50_RS01945 (NCTC8324_00386) | - | 353663..354013 (-) | 351 | WP_011184049.1 | helix-turn-helix domain-containing protein | - |
| DQM50_RS01950 (NCTC8324_00387) | - | 354654..354845 (+) | 192 | WP_001283052.1 | hypothetical protein | - |
| DQM50_RS01955 (NCTC8324_00388) | - | 354896..355096 (+) | 201 | WP_227868729.1 | hypothetical protein | - |
| DQM50_RS01960 (NCTC8324_00389) | - | 355184..355441 (+) | 258 | WP_047149513.1 | hypothetical protein | - |
| DQM50_RS01965 (NCTC8324_00390) | - | 355470..355640 (+) | 171 | WP_023611037.1 | hypothetical protein | - |
| DQM50_RS01970 (NCTC8324_00391) | - | 355633..355836 (+) | 204 | WP_047149512.1 | hypothetical protein | - |
| DQM50_RS01975 (NCTC8324_00392) | - | 355833..356219 (+) | 387 | WP_047149511.1 | hypothetical protein | - |
| DQM50_RS01980 (NCTC8324_00394) | - | 356365..356568 (+) | 204 | WP_030127426.1 | hypothetical protein | - |
| DQM50_RS01985 (NCTC8324_00395) | - | 356656..356955 (+) | 300 | WP_030127427.1 | hypothetical protein | - |
| DQM50_RS01990 (NCTC8324_00396) | - | 356955..358112 (+) | 1158 | WP_011888943.1 | DUF2800 domain-containing protein | - |
| DQM50_RS01995 (NCTC8324_00397) | - | 358121..358684 (+) | 564 | WP_086934854.1 | DUF2815 family protein | - |
| DQM50_RS02000 (NCTC8324_00398) | - | 358727..360649 (+) | 1923 | WP_111688400.1 | DNA polymerase | - |
| DQM50_RS02005 (NCTC8324_00399) | - | 360654..363038 (+) | 2385 | WP_111688401.1 | phage/plasmid primase, P4 family | - |
| DQM50_RS02010 (NCTC8324_00400) | - | 363405..363680 (+) | 276 | WP_023613183.1 | VRR-NUC domain-containing protein | - |
| DQM50_RS02015 (NCTC8324_00401) | - | 363677..364999 (+) | 1323 | WP_111688402.1 | SNF2-related protein | - |
| DQM50_RS09935 (NCTC8324_00402) | - | 365000..365170 (+) | 171 | WP_011054883.1 | hypothetical protein | - |
| DQM50_RS02020 (NCTC8324_00403) | - | 365163..365435 (+) | 273 | WP_011054882.1 | hypothetical protein | - |
| DQM50_RS02025 (NCTC8324_00405) | - | 365568..365984 (+) | 417 | WP_011054881.1 | transcriptional regulator | - |
| DQM50_RS02030 (NCTC8324_00406) | - | 366032..366524 (+) | 493 | Protein_342 | terminase small subunit | - |
| DQM50_RS02035 (NCTC8324_00407) | - | 366514..367791 (+) | 1278 | WP_011054879.1 | PBSX family phage terminase large subunit | - |
| DQM50_RS02040 (NCTC8324_00408) | - | 367807..369339 (+) | 1533 | WP_038433243.1 | phage portal protein | - |
| DQM50_RS02045 (NCTC8324_00409) | - | 369299..370747 (+) | 1449 | WP_032465703.1 | minor capsid protein | - |
| DQM50_RS02050 | - | 370775..370963 (+) | 189 | WP_011054876.1 | hypothetical protein | - |
| DQM50_RS02055 (NCTC8324_00411) | - | 370968..371234 (+) | 267 | WP_011888934.1 | hypothetical protein | - |
| DQM50_RS02060 (NCTC8324_00412) | - | 371396..371965 (+) | 570 | WP_011888933.1 | DUF4355 domain-containing protein | - |
| DQM50_RS02065 (NCTC8324_00413) | - | 371978..372865 (+) | 888 | WP_002983429.1 | hypothetical protein | - |
| DQM50_RS02070 (NCTC8324_00414) | - | 372877..373233 (+) | 357 | WP_011888932.1 | phage head-tail connector protein | - |
| DQM50_RS02075 (NCTC8324_00415) | - | 373244..373522 (+) | 279 | WP_011054872.1 | hypothetical protein | - |
| DQM50_RS02080 (NCTC8324_00416) | - | 373519..373863 (+) | 345 | WP_011106640.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| DQM50_RS02085 (NCTC8324_00417) | - | 373867..374226 (+) | 360 | WP_011054870.1 | hypothetical protein | - |
| DQM50_RS02090 (NCTC8324_00418) | - | 374238..374837 (+) | 600 | WP_011054869.1 | phage major tail protein, TP901-1 family | - |
| DQM50_RS02095 (NCTC8324_00419) | - | 374891..375346 (+) | 456 | WP_011888931.1 | tail assembly chaperone | - |
| DQM50_RS02100 (NCTC8324_00420) | - | 375421..375654 (+) | 234 | WP_011888930.1 | hypothetical protein | - |
| DQM50_RS02105 (NCTC8324_00421) | - | 375669..380051 (+) | 4383 | WP_111688404.1 | tape measure protein | - |
| DQM50_RS02110 (NCTC8324_00422) | - | 380063..380905 (+) | 843 | WP_011054865.1 | phage tail family protein | - |
| DQM50_RS02115 (NCTC8324_00423) | - | 380915..382894 (+) | 1980 | WP_011888928.1 | phage tail protein | - |
| DQM50_RS02120 (NCTC8324_00424) | - | 382891..384006 (+) | 1116 | WP_011888927.1 | hyaluronoglucosaminidase | - |
| DQM50_RS02125 (NCTC8324_00425) | - | 384021..385925 (+) | 1905 | WP_011017395.1 | gp58-like family protein | - |
| DQM50_RS02130 (NCTC8324_00426) | - | 385937..386365 (+) | 429 | WP_002988448.1 | DUF1617 family protein | - |
| DQM50_RS02135 (NCTC8324_00427) | - | 386368..387006 (+) | 639 | WP_046735270.1 | hypothetical protein | - |
| DQM50_RS02140 (NCTC8324_00428) | - | 387018..387290 (+) | 273 | WP_011017397.1 | hypothetical protein | - |
| DQM50_RS02145 (NCTC8324_00429) | - | 387287..387514 (+) | 228 | WP_029714020.1 | phage holin | - |
| DQM50_RS02150 (NCTC8324_00431) | - | 387637..388842 (+) | 1206 | WP_047149505.1 | glucosaminidase domain-containing protein | - |
| DQM50_RS02155 (NCTC8324_00433) | prx | 389539..389721 (+) | 183 | WP_047149504.1 | hypothetical protein | Regulator |
| DQM50_RS02160 (NCTC8324_00434) | uvrA | 389948..392776 (+) | 2829 | WP_032465207.1 | excinuclease ABC subunit UvrA | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6865.91 Da Isoelectric Point: 3.9764
>NTDB_id=1137755 DQM50_RS02155 WP_047149504.1 389539..389721(+) (prx) [Streptococcus pyogenes strain NCTC8324]
MLTYDEFKQAIDNGYITADTVMIVRKNGQIFDYVLPGEPVRPWEVMTVEVAGEVMVELDK
MLTYDEFKQAIDNGYITADTVMIVRKNGQIFDYVLPGEPVRPWEVMTVEVAGEVMVELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=1137755 DQM50_RS02155 WP_047149504.1 389539..389721(+) (prx) [Streptococcus pyogenes strain NCTC8324]
ATGCTAACATACGACGAGTTTAAGCAAGCAATTGACAATGGATATATCACAGCAGACACAGTTATGATCGTGCGTAAAAA
TGGACAGATTTTTGATTATGTTTTGCCCGGTGAGCCTGTGAGACCGTGGGAGGTTATGACAGTTGAAGTAGCGGGAGAAG
TGATGGTGGAATTAGACAAATAA
ATGCTAACATACGACGAGTTTAAGCAAGCAATTGACAATGGATATATCACAGCAGACACAGTTATGATCGTGCGTAAAAA
TGGACAGATTTTTGATTATGTTTTGCCCGGTGAGCCTGTGAGACCGTGGGAGGTTATGACAGTTGAAGTAGCGGGAGAAG
TGATGGTGGAATTAGACAAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS8232 |
71.667 |
100 |
0.717 |
| prx | Streptococcus pyogenes MGAS315 |
85.366 |
68.333 |
0.583 |
| prx | Streptococcus pyogenes MGAS315 |
75.61 |
68.333 |
0.517 |