Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | DQL30_RS03220 | Genome accession | NZ_LS483333 |
| Coordinates | 578510..578692 (+) | Length | 60 a.a. |
| NCBI ID | WP_111713703.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain NCTC12048 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 539303..578692 | 578510..578692 | within | 0 |
Gene organization within MGE regions
Location: 539303..578692
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQL30_RS02915 (NCTC12048_00572) | - | 539303..540469 (-) | 1167 | WP_011018152.1 | tyrosine-type recombinase/integrase | - |
| DQL30_RS02920 (NCTC12048_00573) | - | 540642..541328 (-) | 687 | WP_111713667.1 | hypothetical protein | - |
| DQL30_RS02925 (NCTC12048_00574) | - | 541358..541651 (-) | 294 | WP_111713668.1 | hypothetical protein | - |
| DQL30_RS02930 (NCTC12048_00575) | - | 541662..542039 (-) | 378 | WP_011054824.1 | ImmA/IrrE family metallo-endopeptidase | - |
| DQL30_RS02935 (NCTC12048_00576) | - | 542023..542382 (-) | 360 | WP_111713669.1 | helix-turn-helix domain-containing protein | - |
| DQL30_RS02940 (NCTC12048_00577) | - | 542571..542789 (+) | 219 | WP_009881062.1 | helix-turn-helix domain-containing protein | - |
| DQL30_RS02945 (NCTC12048_00578) | - | 542884..543135 (+) | 252 | WP_111713670.1 | helix-turn-helix transcriptional regulator | - |
| DQL30_RS09375 (NCTC12048_00579) | - | 543166..543300 (+) | 135 | WP_021340229.1 | hypothetical protein | - |
| DQL30_RS02950 (NCTC12048_00580) | - | 543316..543630 (+) | 315 | WP_043885080.1 | helix-turn-helix domain-containing protein | - |
| DQL30_RS02955 (NCTC12048_00581) | - | 543644..544600 (+) | 957 | WP_111713671.1 | phage replisome organizer N-terminal domain-containing protein | - |
| DQL30_RS02960 (NCTC12048_00582) | - | 544610..545452 (+) | 843 | WP_011018146.1 | ATP-binding protein | - |
| DQL30_RS09115 (NCTC12048_00583) | - | 545452..545589 (+) | 138 | WP_011285580.1 | hypothetical protein | - |
| DQL30_RS02965 (NCTC12048_00584) | - | 545602..545955 (+) | 354 | WP_011285579.1 | hypothetical protein | - |
| DQL30_RS02970 (NCTC12048_00585) | - | 545936..546190 (+) | 255 | WP_011018143.1 | hypothetical protein | - |
| DQL30_RS02975 (NCTC12048_00586) | - | 546212..546694 (+) | 483 | WP_111713672.1 | siphovirus Gp157 family protein | - |
| DQL30_RS02980 (NCTC12048_00587) | - | 546695..547369 (+) | 675 | WP_111713673.1 | ERF family protein | - |
| DQL30_RS02985 (NCTC12048_00588) | ssb | 547362..547787 (+) | 426 | WP_111713674.1 | single-stranded DNA-binding protein | Machinery gene |
| DQL30_RS02990 (NCTC12048_00589) | - | 547800..548006 (+) | 207 | WP_063812419.1 | hypothetical protein | - |
| DQL30_RS02995 (NCTC12048_00590) | - | 548006..548446 (+) | 441 | WP_111713675.1 | RusA family crossover junction endodeoxyribonuclease | - |
| DQL30_RS03000 (NCTC12048_00591) | - | 548443..548799 (+) | 357 | WP_011284873.1 | hypothetical protein | - |
| DQL30_RS09435 (NCTC12048_00592) | - | 548796..549047 (+) | 252 | WP_032459778.1 | hypothetical protein | - |
| DQL30_RS09505 | - | 549041..549323 (+) | 283 | Protein_517 | DUF3310 domain-containing protein | - |
| DQL30_RS09255 | - | 549305..549463 (+) | 159 | Protein_518 | SAM-dependent methyltransferase | - |
| DQL30_RS03020 (NCTC12048_00594) | - | 549654..550055 (+) | 402 | WP_111713677.1 | hypothetical protein | - |
| DQL30_RS03025 (NCTC12048_00595) | - | 550055..550690 (+) | 636 | WP_011054572.1 | N-6 DNA methylase | - |
| DQL30_RS03030 (NCTC12048_00596) | - | 550963..551403 (+) | 441 | WP_011054571.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| DQL30_RS09120 | - | 551849..552106 (-) | 258 | WP_172449893.1 | hypothetical protein | - |
| DQL30_RS03040 (NCTC12048_00597) | - | 552186..552704 (+) | 519 | WP_111713678.1 | ParB N-terminal domain-containing protein | - |
| DQL30_RS09260 (NCTC12048_00598) | - | 552683..553060 (+) | 378 | WP_231871048.1 | hypothetical protein | - |
| DQL30_RS09265 (NCTC12048_00599) | - | 553045..553359 (+) | 315 | WP_231871049.1 | hypothetical protein | - |
| DQL30_RS09180 | - | 553368..553751 (+) | 384 | WP_231871052.1 | GNAT family N-acetyltransferase | - |
| DQL30_RS03055 (NCTC12048_00600) | - | 553812..554060 (+) | 249 | WP_231871050.1 | ASCH domain-containing protein | - |
| DQL30_RS03060 (NCTC12048_00601) | - | 554240..554689 (+) | 450 | WP_281726933.1 | hypothetical protein | - |
| DQL30_RS03065 (NCTC12048_00602) | - | 554686..555909 (+) | 1224 | WP_111713680.1 | PBSX family phage terminase large subunit | - |
| DQL30_RS03070 (NCTC12048_00603) | - | 555909..557234 (+) | 1326 | WP_111713681.1 | phage portal protein | - |
| DQL30_RS03075 (NCTC12048_00604) | - | 557203..558111 (+) | 909 | WP_111713682.1 | minor capsid protein | - |
| DQL30_RS03080 (NCTC12048_00605) | - | 558118..558351 (+) | 234 | WP_111713683.1 | hypothetical protein | - |
| DQL30_RS03085 (NCTC12048_00606) | - | 558459..559028 (+) | 570 | WP_111713684.1 | DUF4355 domain-containing protein | - |
| DQL30_RS03090 (NCTC12048_00607) | - | 559047..559937 (+) | 891 | WP_111713685.1 | phage capsid protein | - |
| DQL30_RS03095 (NCTC12048_00608) | - | 559950..560243 (+) | 294 | WP_111713686.1 | HeH/LEM domain-containing protein | - |
| DQL30_RS03100 (NCTC12048_00609) | - | 560257..560601 (+) | 345 | WP_111713687.1 | hypothetical protein | - |
| DQL30_RS03105 (NCTC12048_00610) | - | 560598..560909 (+) | 312 | WP_009880258.1 | hypothetical protein | - |
| DQL30_RS03110 (NCTC12048_00611) | - | 560906..561301 (+) | 396 | WP_048327815.1 | antigen C | - |
| DQL30_RS03115 (NCTC12048_00612) | - | 561303..561713 (+) | 411 | WP_111713688.1 | DUF5072 family protein | - |
| DQL30_RS03120 (NCTC12048_00613) | - | 561725..562231 (+) | 507 | WP_111713689.1 | phage major tail protein, TP901-1 family | - |
| DQL30_RS03125 (NCTC12048_00614) | - | 562244..562561 (+) | 318 | WP_011528563.1 | hypothetical protein | - |
| DQL30_RS03130 (NCTC12048_00615) | - | 562693..562992 (+) | 300 | WP_228637123.1 | hypothetical protein | - |
| DQL30_RS03135 (NCTC12048_00616) | - | 562985..564790 (+) | 1806 | WP_111713691.1 | phage tail protein | - |
| DQL30_RS03140 (NCTC12048_00617) | - | 564791..566275 (+) | 1485 | WP_009880250.1 | distal tail protein Dit | - |
| DQL30_RS03145 (NCTC12048_00618) | - | 566276..569716 (+) | 3441 | WP_111713692.1 | glucosaminidase domain-containing protein | - |
| DQL30_RS03150 (NCTC12048_00619) | - | 569721..571583 (+) | 1863 | WP_011528568.1 | DUF859 family phage minor structural protein | - |
| DQL30_RS03155 (NCTC12048_00620) | - | 571594..571941 (+) | 348 | WP_009880247.1 | DUF1366 domain-containing protein | - |
| DQL30_RS09380 (NCTC12048_00621) | - | 571955..572077 (+) | 123 | WP_015055953.1 | hypothetical protein | - |
| DQL30_RS03160 (NCTC12048_00622) | - | 572091..572414 (+) | 324 | WP_015055952.1 | hypothetical protein | - |
| DQL30_RS03165 (NCTC12048_00623) | - | 572414..572746 (+) | 333 | WP_111713693.1 | phage holin | - |
| DQL30_RS03170 (NCTC12048_00624) | - | 572748..573512 (+) | 765 | WP_111713694.1 | CHAP domain-containing protein | - |
| DQL30_RS03175 (NCTC12048_00625) | - | 573524..574126 (+) | 603 | WP_111713695.1 | hypothetical protein | - |
| DQL30_RS03180 (NCTC12048_00626) | - | 574137..574910 (+) | 774 | WP_111713696.1 | hypothetical protein | - |
| DQL30_RS03185 (NCTC12048_00627) | - | 574920..575141 (+) | 222 | WP_009880241.1 | hypothetical protein | - |
| DQL30_RS03190 (NCTC12048_00628) | - | 575141..575800 (+) | 660 | WP_111713697.1 | hypothetical protein | - |
| DQL30_RS03195 (NCTC12048_00629) | - | 575958..576488 (+) | 531 | WP_111713698.1 | Panacea domain-containing protein | - |
| DQL30_RS03200 (NCTC12048_00630) | - | 576470..577276 (+) | 807 | WP_111713699.1 | hypothetical protein | - |
| DQL30_RS03205 (NCTC12048_00631) | - | 577332..577517 (-) | 186 | WP_111713700.1 | helix-turn-helix domain-containing protein | - |
| DQL30_RS03210 (NCTC12048_00632) | - | 577514..577993 (-) | 480 | WP_111713701.1 | hypothetical protein | - |
| DQL30_RS03215 (NCTC12048_00633) | - | 578026..578334 (-) | 309 | WP_111713702.1 | hypothetical protein | - |
| DQL30_RS03220 (NCTC12048_00634) | prx | 578510..578692 (+) | 183 | WP_111713703.1 | Paratox | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 7024.02 Da Isoelectric Point: 3.9286
>NTDB_id=1137025 DQL30_RS03220 WP_111713703.1 578510..578692(+) (prx) [Streptococcus pyogenes strain NCTC12048]
MLTYDEFKQAIDDGYITGDTVAIVRKNGQIFDYVLPGEPVRPWEMLMEERVEEVMVELDK
MLTYDEFKQAIDDGYITGDTVAIVRKNGQIFDYVLPGEPVRPWEMLMEERVEEVMVELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=1137025 DQL30_RS03220 WP_111713703.1 578510..578692(+) (prx) [Streptococcus pyogenes strain NCTC12048]
ATGCTAACATACGATGAGTTTAAGCAAGCTATTGATGACGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCTGGTGAGCCTGTTAGACCGTGGGAGATGTTAATGGAAGAAAGAGTGGAAGAAG
TGATGGTGGAATTAGACAAATAA
ATGCTAACATACGATGAGTTTAAGCAAGCTATTGATGACGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCTGGTGAGCCTGTTAGACCGTGGGAGATGTTAATGGAAGAAAGAGTGGAAGAAG
TGATGGTGGAATTAGACAAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
81.667 |
100 |
0.817 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS8232 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
71.667 |
100 |
0.717 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
68.333 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
80.488 |
68.333 |
0.55 |