Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | DQL25_RS03985 | Genome accession | NZ_LS483330 |
| Coordinates | 736941..737123 (+) | Length | 60 a.a. |
| NCBI ID | WP_014635572.1 | Uniprot ID | A0A8B6J386 |
| Organism | Streptococcus pyogenes strain NCTC8328 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 701805..737123 | 736941..737123 | within | 0 |
Gene organization within MGE regions
Location: 701805..737123
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQL25_RS03720 (NCTC8328_00738) | - | 701805..702080 (+) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| DQL25_RS03725 (NCTC8328_00739) | - | 702169..703311 (-) | 1143 | WP_003051793.1 | tyrosine-type recombinase/integrase | - |
| DQL25_RS03730 (NCTC8328_00740) | - | 703435..703953 (-) | 519 | WP_010922481.1 | HIRAN domain-containing protein | - |
| DQL25_RS03735 (NCTC8328_00741) | - | 703965..704720 (-) | 756 | WP_010922480.1 | helix-turn-helix domain-containing protein | - |
| DQL25_RS03740 (NCTC8328_00742) | - | 704922..705134 (+) | 213 | WP_010922479.1 | helix-turn-helix domain-containing protein | - |
| DQL25_RS03745 (NCTC8328_00744) | - | 705404..705715 (+) | 312 | WP_010922478.1 | excisionase | - |
| DQL25_RS03750 (NCTC8328_00745) | - | 705717..705902 (+) | 186 | WP_010922477.1 | hypothetical protein | - |
| DQL25_RS09695 | - | 705996..706265 (+) | 270 | WP_011106700.1 | replication protein | - |
| DQL25_RS03760 (NCTC8328_00746) | - | 706391..706777 (+) | 387 | WP_011017564.1 | DnaD domain-containing protein | - |
| DQL25_RS03765 (NCTC8328_00747) | - | 706758..706991 (+) | 234 | WP_010922205.1 | hypothetical protein | - |
| DQL25_RS03770 (NCTC8328_00748) | - | 706988..707128 (+) | 141 | WP_002988354.1 | hypothetical protein | - |
| DQL25_RS03775 (NCTC8328_00749) | - | 707137..707343 (+) | 207 | WP_002988357.1 | hypothetical protein | - |
| DQL25_RS03780 (NCTC8328_00750) | - | 707399..707728 (+) | 330 | WP_011528796.1 | hypothetical protein | - |
| DQL25_RS03785 (NCTC8328_00751) | - | 707731..708657 (+) | 927 | WP_011054700.1 | recombinase RecT | - |
| DQL25_RS03790 (NCTC8328_00752) | - | 708654..708854 (+) | 201 | WP_000594115.1 | hypothetical protein | - |
| DQL25_RS03795 (NCTC8328_00753) | - | 708847..709644 (+) | 798 | WP_011054699.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| DQL25_RS03800 (NCTC8328_00755) | - | 710009..710404 (+) | 396 | WP_011054698.1 | Cas9 inhibitor AcrIIA9 family protein | - |
| DQL25_RS03805 (NCTC8328_00756) | - | 710401..711747 (+) | 1347 | WP_011054697.1 | PcfJ domain-containing protein | - |
| DQL25_RS03810 (NCTC8328_00757) | - | 711758..712090 (+) | 333 | WP_011184741.1 | hypothetical protein | - |
| DQL25_RS03815 (NCTC8328_00758) | - | 712087..712599 (+) | 513 | WP_011054695.1 | hypothetical protein | - |
| DQL25_RS03820 (NCTC8328_00759) | - | 712635..712952 (+) | 318 | WP_011054694.1 | DUF1372 family protein | - |
| DQL25_RS09580 (NCTC8328_00760) | - | 712949..713104 (+) | 156 | WP_011054693.1 | hypothetical protein | - |
| DQL25_RS03825 (NCTC8328_00761) | - | 713101..713352 (+) | 252 | WP_011054692.1 | hypothetical protein | - |
| DQL25_RS03830 (NCTC8328_00762) | - | 713428..713847 (+) | 420 | WP_011528791.1 | DUF1492 domain-containing protein | - |
| DQL25_RS03835 | - | 713955..714299 (+) | 345 | WP_011054690.1 | HNH endonuclease signature motif containing protein | - |
| DQL25_RS03840 (NCTC8328_00763) | - | 714447..714803 (+) | 357 | WP_002994106.1 | hypothetical protein | - |
| DQL25_RS03845 (NCTC8328_00764) | - | 714800..716068 (+) | 1269 | WP_111703209.1 | phage portal protein | - |
| DQL25_RS03850 (NCTC8328_00765) | - | 716061..717554 (+) | 1494 | WP_010922467.1 | hypothetical protein | - |
| DQL25_RS03855 (NCTC8328_00766) | - | 717560..717784 (+) | 225 | WP_002994100.1 | hypothetical protein | - |
| DQL25_RS09585 (NCTC8328_00767) | - | 717861..718013 (+) | 153 | WP_011054687.1 | hypothetical protein | - |
| DQL25_RS03860 (NCTC8328_00768) | - | 718006..718272 (+) | 267 | WP_002986828.1 | hypothetical protein | - |
| DQL25_RS03865 (NCTC8328_00769) | - | 718274..718489 (+) | 216 | WP_011106704.1 | hypothetical protein | - |
| DQL25_RS03870 (NCTC8328_00770) | - | 718571..719986 (+) | 1416 | WP_011054685.1 | terminase | - |
| DQL25_RS03875 (NCTC8328_00771) | - | 720067..720528 (+) | 462 | WP_010922462.1 | capsid assembly scaffolding protein Gp46 family protein | - |
| DQL25_RS03880 (NCTC8328_00772) | - | 720553..721464 (+) | 912 | WP_011054683.1 | phage major capsid protein | - |
| DQL25_RS03885 (NCTC8328_00773) | - | 721464..721664 (+) | 201 | WP_010922460.1 | hypothetical protein | - |
| DQL25_RS03890 (NCTC8328_00774) | - | 721674..722096 (+) | 423 | WP_011054682.1 | phage Gp19/Gp15/Gp42 family protein | - |
| DQL25_RS03895 (NCTC8328_00775) | - | 722056..722394 (+) | 339 | WP_011054681.1 | hypothetical protein | - |
| DQL25_RS03900 (NCTC8328_00776) | - | 722387..722623 (+) | 237 | WP_000032787.1 | hypothetical protein | - |
| DQL25_RS03905 (NCTC8328_00777) | - | 722624..722959 (+) | 336 | WP_000573598.1 | hypothetical protein | - |
| DQL25_RS03910 (NCTC8328_00778) | - | 722975..723565 (+) | 591 | WP_011054679.1 | hypothetical protein | - |
| DQL25_RS03915 (NCTC8328_00779) | - | 723576..723839 (+) | 264 | WP_010922455.1 | hypothetical protein | - |
| DQL25_RS03920 (NCTC8328_00780) | - | 723854..724225 (+) | 372 | WP_011054678.1 | DUF5361 domain-containing protein | - |
| DQL25_RS03925 (NCTC8328_00781) | - | 724225..726588 (+) | 2364 | WP_111703210.1 | hypothetical protein | - |
| DQL25_RS03930 (NCTC8328_00782) | - | 726585..727280 (+) | 696 | WP_002992579.1 | hypothetical protein | - |
| DQL25_RS03935 (NCTC8328_00783) | - | 727262..729235 (+) | 1974 | WP_168388764.1 | phage tail spike protein | - |
| DQL25_RS03940 (NCTC8328_00784) | hylP | 729235..730344 (+) | 1110 | WP_111703211.1 | hyaluronoglucosaminidase | - |
| DQL25_RS03945 (NCTC8328_00785) | - | 730359..732140 (+) | 1782 | WP_111703212.1 | gp58-like family protein | - |
| DQL25_RS03950 (NCTC8328_00786) | - | 732149..732577 (+) | 429 | WP_011528780.1 | DUF1617 family protein | - |
| DQL25_RS03955 (NCTC8328_00787) | - | 732580..733212 (+) | 633 | WP_011528779.1 | hypothetical protein | - |
| DQL25_RS03960 (NCTC8328_00788) | - | 733224..733496 (+) | 273 | WP_011017397.1 | hypothetical protein | - |
| DQL25_RS03965 (NCTC8328_00789) | - | 733493..733720 (+) | 228 | WP_111703213.1 | phage holin | - |
| DQL25_RS03970 (NCTC8328_00791) | - | 733839..735056 (+) | 1218 | WP_014635574.1 | peptidoglycan amidohydrolase family protein | - |
| DQL25_RS03975 (NCTC8328_00792) | speC | 735125..735832 (-) | 708 | WP_002985327.1 | streptococcal pyrogenic exotoxin SpeC | - |
| DQL25_RS03980 (NCTC8328_00793) | mf2 | 735943..736701 (-) | 759 | WP_014635573.1 | DNase Mf2 | - |
| DQL25_RS03985 (NCTC8328_00794) | prx | 736941..737123 (+) | 183 | WP_014635572.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 7067.01 Da Isoelectric Point: 4.1079
>NTDB_id=1136857 DQL25_RS03985 WP_014635572.1 736941..737123(+) (prx) [Streptococcus pyogenes strain NCTC8328]
MLTYDEFKQAIDNGYITGDTVMIVRKNGQIFDYVLPNEKIRDWEVVTDEKVEEVLVELSR
MLTYDEFKQAIDNGYITGDTVMIVRKNGQIFDYVLPNEKIRDWEVVTDEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=1136857 DQL25_RS03985 WP_014635572.1 736941..737123(+) (prx) [Streptococcus pyogenes strain NCTC8328]
ATGCTAACATACGACGAATTTAAGCAAGCAATTGACAACGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCGAATGAGAAGATAAGAGATTGGGAGGTTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAATTTAAGCAAGCAATTGACAACGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCGAATGAGAAGATAAGAGATTGGGAGGTTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
90 |
100 |
0.9 |
| prx | Streptococcus pyogenes MGAS8232 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
85.714 |
70 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |