Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   FXY05_RS07665 Genome accession   NZ_LR698956
Coordinates   1541119..1541232 (-) Length   37 a.a.
NCBI ID   WP_001217868.1    Uniprot ID   A0AAE7DTV1
Organism   Helicobacter pylori isolate MGYG-HGUT-01357     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1536119..1546232
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FXY05_RS07645 - 1536806..1538218 (-) 1413 WP_000694826.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -
  FXY05_RS07650 comB10 1538288..1539424 (-) 1137 WP_001045733.1 DNA type IV secretion system protein ComB10 Machinery gene
  FXY05_RS07655 comB9 1539417..1540379 (-) 963 WP_014534693.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  FXY05_RS07660 comB8 1540379..1541122 (-) 744 WP_000660529.1 type IV secretion system protein Machinery gene
  FXY05_RS07665 comB7 1541119..1541232 (-) 114 WP_001217868.1 hypothetical protein Machinery gene
  FXY05_RS07670 comB6 1541248..1542303 (-) 1056 WP_000786700.1 P-type conjugative transfer protein TrbL Machinery gene
  FXY05_RS07675 - 1542311..1543306 (-) 996 WP_000468806.1 PDZ domain-containing protein -
  FXY05_RS07680 - 1543306..1543599 (-) 294 WP_000347922.1 YbaB/EbfC family nucleoid-associated protein -
  FXY05_RS07685 panD 1543610..1543960 (-) 351 WP_000142214.1 aspartate 1-decarboxylase -
  FXY05_RS07690 - 1543950..1546172 (-) 2223 WP_001051538.1 AAA family ATPase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4323.29 Da        Isoelectric Point: 9.3572

>NTDB_id=1128678 FXY05_RS07665 WP_001217868.1 1541119..1541232(-) (comB7) [Helicobacter pylori isolate MGYG-HGUT-01357]
MRIFFVIMGIMLFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=1128678 FXY05_RS07665 WP_001217868.1 1541119..1541232(-) (comB7) [Helicobacter pylori isolate MGYG-HGUT-01357]
ATGAGAATTTTTTTTGTTATTATGGGAATCATGTTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGTATGAAAACAGGTTGAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

91.892

100

0.919


Multiple sequence alignment