Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   ACJGE4_RS15940 Genome accession   NZ_CP174519
Coordinates   3194990..3195130 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain JD-3     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3189990..3200130
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACJGE4_RS15915 (ACJGE4_15915) - 3190286..3190669 (-) 384 WP_007408674.1 hotdog fold thioesterase -
  ACJGE4_RS15920 (ACJGE4_15920) comA 3190691..3191335 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  ACJGE4_RS15925 (ACJGE4_15925) comP 3191416..3193725 (-) 2310 WP_033574914.1 histidine kinase Regulator
  ACJGE4_RS15930 (ACJGE4_15930) - 3193745..3193921 (-) 177 WP_007408675.1 competence pheromone ComX -
  ACJGE4_RS15935 (ACJGE4_15935) comQ 3193921..3194859 (-) 939 WP_020954300.1 polyprenyl synthetase family protein Regulator
  ACJGE4_RS15940 (ACJGE4_15940) degQ 3194990..3195130 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  ACJGE4_RS15945 (ACJGE4_15945) - 3195596..3195937 (+) 342 WP_015418107.1 hypothetical protein -
  ACJGE4_RS15950 (ACJGE4_15950) - 3195944..3197167 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  ACJGE4_RS15955 (ACJGE4_15955) - 3197297..3198763 (-) 1467 WP_020954301.1 nicotinate phosphoribosyltransferase -
  ACJGE4_RS15960 (ACJGE4_15960) - 3198781..3199332 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  ACJGE4_RS15965 (ACJGE4_15965) - 3199429..3199827 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=1077746 ACJGE4_RS15940 WP_003152043.1 3194990..3195130(-) (degQ) [Bacillus velezensis strain JD-3]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1077746 ACJGE4_RS15940 WP_003152043.1 3194990..3195130(-) (degQ) [Bacillus velezensis strain JD-3]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment