Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | ACB344_RS06075 | Genome accession | NZ_CP167018 |
| Coordinates | 1210306..1210488 (-) | Length | 60 a.a. |
| NCBI ID | WP_011528776.1 | Uniprot ID | A0A660A5W9 |
| Organism | Streptococcus pyogenes strain Isolate 8 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1210306..1236973 | 1210306..1210488 | within | 0 |
Gene organization within MGE regions
Location: 1210306..1236973
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACB344_RS06075 (ACB344_06075) | prx | 1210306..1210488 (-) | 183 | WP_011528776.1 | hypothetical protein | Regulator |
| ACB344_RS06080 (ACB344_06080) | entC3 | 1210601..1211383 (-) | 783 | WP_002988472.1 | enterotoxin type C3 EntC3 | - |
| ACB344_RS06085 (ACB344_06085) | - | 1211631..1212755 (-) | 1125 | WP_002988467.1 | Fic family protein | - |
| ACB344_RS06090 (ACB344_06090) | - | 1212891..1214108 (-) | 1218 | WP_011528778.1 | peptidoglycan amidohydrolase family protein | - |
| ACB344_RS06095 (ACB344_06095) | - | 1214227..1214454 (-) | 228 | WP_003058873.1 | phage holin | - |
| ACB344_RS06100 (ACB344_06100) | - | 1214451..1214723 (-) | 273 | WP_011017397.1 | hypothetical protein | - |
| ACB344_RS06105 (ACB344_06105) | - | 1214735..1215367 (-) | 633 | WP_011528779.1 | hypothetical protein | - |
| ACB344_RS06110 (ACB344_06110) | - | 1215370..1215798 (-) | 429 | WP_011528780.1 | DUF1617 family protein | - |
| ACB344_RS06115 (ACB344_06115) | - | 1215807..1217588 (-) | 1782 | WP_011528781.1 | gp58-like family protein | - |
| ACB344_RS06120 (ACB344_06120) | hylP | 1217603..1218718 (-) | 1116 | WP_011528782.1 | hyaluronoglucosaminidase | - |
| ACB344_RS06125 (ACB344_06125) | - | 1218715..1220691 (-) | 1977 | WP_011528783.1 | phage tail spike protein | - |
| ACB344_RS06130 (ACB344_06130) | - | 1220673..1221368 (-) | 696 | WP_002992579.1 | hypothetical protein | - |
| ACB344_RS06135 (ACB344_06135) | - | 1221365..1223722 (-) | 2358 | WP_011528784.1 | hypothetical protein | - |
| ACB344_RS06140 (ACB344_06140) | - | 1223722..1224093 (-) | 372 | WP_011528785.1 | DUF5361 domain-containing protein | - |
| ACB344_RS06145 (ACB344_06145) | - | 1224108..1224371 (-) | 264 | WP_003047548.1 | hypothetical protein | - |
| ACB344_RS06150 (ACB344_06150) | - | 1224382..1224960 (-) | 579 | WP_014635577.1 | hypothetical protein | - |
| ACB344_RS06155 (ACB344_06155) | - | 1224972..1225307 (-) | 336 | WP_011528787.1 | hypothetical protein | - |
| ACB344_RS06160 (ACB344_06160) | - | 1225308..1225544 (-) | 237 | WP_000032787.1 | hypothetical protein | - |
| ACB344_RS06165 (ACB344_06165) | - | 1225537..1225874 (-) | 338 | Protein_1170 | hypothetical protein | - |
| ACB344_RS06170 (ACB344_06170) | - | 1225834..1226256 (-) | 423 | WP_011054682.1 | phage Gp19/Gp15/Gp42 family protein | - |
| ACB344_RS06175 (ACB344_06175) | - | 1226266..1226466 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| ACB344_RS06180 (ACB344_06180) | - | 1226466..1227377 (-) | 912 | WP_011528788.1 | phage major capsid protein | - |
| ACB344_RS06185 (ACB344_06185) | - | 1227402..1227863 (-) | 462 | WP_010922462.1 | DUF4355 domain-containing protein | - |
| ACB344_RS06190 (ACB344_06190) | - | 1227943..1229358 (-) | 1416 | WP_021299324.1 | phage terminase large subunit-like protein | - |
| ACB344_RS06195 (ACB344_06195) | - | 1229440..1229676 (-) | 237 | Protein_1176 | hypothetical protein | - |
| ACB344_RS06200 (ACB344_06200) | - | 1229678..1229944 (-) | 267 | WP_011054745.1 | hypothetical protein | - |
| ACB344_RS06205 (ACB344_06205) | - | 1229996..1230220 (-) | 225 | WP_002994100.1 | hypothetical protein | - |
| ACB344_RS06210 (ACB344_06210) | - | 1230226..1231719 (-) | 1494 | WP_010922467.1 | hypothetical protein | - |
| ACB344_RS06215 (ACB344_06215) | - | 1231712..1232980 (-) | 1269 | WP_010922468.1 | phage portal protein | - |
| ACB344_RS06220 (ACB344_06220) | - | 1232977..1233333 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| ACB344_RS06225 (ACB344_06225) | - | 1233481..1233825 (-) | 345 | WP_011054690.1 | HNH endonuclease signature motif containing protein | - |
| ACB344_RS06230 (ACB344_06230) | - | 1233933..1234352 (-) | 420 | WP_011528791.1 | DUF1492 domain-containing protein | - |
| ACB344_RS06235 (ACB344_06235) | - | 1234531..1234858 (-) | 328 | Protein_1184 | recombinase RecT | - |
| ACB344_RS06240 (ACB344_06240) | - | 1234861..1235190 (-) | 330 | WP_011528796.1 | hypothetical protein | - |
| ACB344_RS06245 (ACB344_06245) | - | 1235246..1235452 (-) | 207 | WP_002988357.1 | hypothetical protein | - |
| ACB344_RS06250 (ACB344_06250) | - | 1235461..1235601 (-) | 141 | WP_002988354.1 | hypothetical protein | - |
| ACB344_RS06255 (ACB344_06255) | - | 1235598..1235832 (-) | 235 | Protein_1188 | hypothetical protein | - |
| ACB344_RS06260 (ACB344_06260) | - | 1235813..1236016 (-) | 204 | Protein_1189 | DNA replication protein | - |
| ACB344_RS06265 (ACB344_06265) | - | 1236013..1236609 (+) | 597 | Protein_1190 | tyrosine-type recombinase/integrase | - |
| ACB344_RS06270 (ACB344_06270) | - | 1236698..1236973 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6840.81 Da Isoelectric Point: 4.7023
>NTDB_id=1037761 ACB344_RS06075 WP_011528776.1 1210306..1210488(-) (prx) [Streptococcus pyogenes strain Isolate 8]
MLTYNEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYNEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=1037761 ACB344_RS06075 WP_011528776.1 1210306..1210488(-) (prx) [Streptococcus pyogenes strain Isolate 8]
ATGCTAACATACAACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACAACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
98.333 |
100 |
0.983 |
| prx | Streptococcus pyogenes MGAS315 |
83.333 |
100 |
0.833 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
71.667 |
100 |
0.717 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
68.333 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
81.395 |
71.667 |
0.583 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
70 |
0.533 |