Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | ACB354_RS03320 | Genome accession | NZ_CP167004 |
| Coordinates | 599597..599779 (+) | Length | 60 a.a. |
| NCBI ID | WP_011018104.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain Isolate 28 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 558284..599779 | 599597..599779 | within | 0 |
Gene organization within MGE regions
Location: 558284..599779
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACB354_RS03010 (ACB354_03010) | - | 558284..559450 (-) | 1167 | WP_011018152.1 | site-specific integrase | - |
| ACB354_RS03015 (ACB354_03015) | - | 559628..561049 (-) | 1422 | WP_011018151.1 | DUF4041 domain-containing protein | - |
| ACB354_RS03020 (ACB354_03020) | - | 561064..561450 (-) | 387 | WP_032463929.1 | ImmA/IrrE family metallo-endopeptidase | - |
| ACB354_RS03025 (ACB354_03025) | - | 561434..561775 (-) | 342 | WP_011888679.1 | helix-turn-helix transcriptional regulator | - |
| ACB354_RS03030 (ACB354_03030) | - | 561973..562185 (+) | 213 | WP_023078130.1 | hypothetical protein | - |
| ACB354_RS03035 (ACB354_03035) | - | 562213..562932 (+) | 720 | WP_011018149.1 | phage antirepressor KilAC domain-containing protein | - |
| ACB354_RS03040 (ACB354_03040) | - | 562936..563103 (+) | 168 | WP_021340232.1 | hypothetical protein | - |
| ACB354_RS03045 (ACB354_03045) | - | 563342..563593 (+) | 252 | WP_021340237.1 | AlpA family transcriptional regulator | - |
| ACB354_RS03050 (ACB354_03050) | - | 563624..563758 (+) | 135 | WP_021340229.1 | hypothetical protein | - |
| ACB354_RS03055 (ACB354_03055) | - | 563774..564088 (+) | 315 | WP_021340228.1 | helix-turn-helix domain-containing protein | - |
| ACB354_RS03060 (ACB354_03060) | - | 564102..565022 (+) | 921 | WP_021340238.1 | phage replisome organizer N-terminal domain-containing protein | - |
| ACB354_RS03065 (ACB354_03065) | - | 565032..565874 (+) | 843 | WP_011018146.1 | ATP-binding protein | - |
| ACB354_RS03070 (ACB354_03070) | - | 565874..566011 (+) | 138 | WP_011018145.1 | hypothetical protein | - |
| ACB354_RS03075 (ACB354_03075) | - | 566022..566378 (+) | 357 | WP_011018144.1 | HTH domain-containing protein | - |
| ACB354_RS03080 (ACB354_03080) | - | 566359..566613 (+) | 255 | WP_011018143.1 | hypothetical protein | - |
| ACB354_RS03085 (ACB354_03085) | - | 566635..567117 (+) | 483 | WP_011018142.1 | siphovirus Gp157 family protein | - |
| ACB354_RS03090 (ACB354_03090) | - | 567118..567792 (+) | 675 | WP_021340321.1 | ERF family protein | - |
| ACB354_RS03095 (ACB354_03095) | ssbA | 567785..568204 (+) | 420 | WP_021340323.1 | single-stranded DNA-binding protein | Machinery gene |
| ACB354_RS03100 (ACB354_03100) | - | 568210..568413 (+) | 204 | WP_011106686.1 | hypothetical protein | - |
| ACB354_RS03105 (ACB354_03105) | - | 568413..568853 (+) | 441 | WP_011285574.1 | RusA family crossover junction endodeoxyribonuclease | - |
| ACB354_RS03110 (ACB354_03110) | - | 568850..569206 (+) | 357 | WP_023078113.1 | hypothetical protein | - |
| ACB354_RS03115 (ACB354_03115) | - | 569203..569454 (+) | 252 | WP_032462267.1 | hypothetical protein | - |
| ACB354_RS03120 (ACB354_03120) | - | 569448..569732 (+) | 285 | WP_011018137.1 | DUF3310 domain-containing protein | - |
| ACB354_RS03125 (ACB354_03125) | - | 569729..570133 (+) | 405 | WP_011018136.1 | YopX family protein | - |
| ACB354_RS03130 (ACB354_03130) | - | 570130..570300 (+) | 171 | WP_011018135.1 | hypothetical protein | - |
| ACB354_RS03135 (ACB354_03135) | - | 570297..570581 (+) | 285 | WP_011018134.1 | hypothetical protein | - |
| ACB354_RS03140 (ACB354_03140) | - | 570583..571215 (+) | 633 | WP_011018133.1 | N-6 DNA methylase | - |
| ACB354_RS03145 (ACB354_03145) | - | 571336..571707 (+) | 372 | WP_011018132.1 | DUF1642 domain-containing protein | - |
| ACB354_RS03150 (ACB354_03150) | - | 571704..571970 (+) | 267 | WP_011018131.1 | hypothetical protein | - |
| ACB354_RS03155 (ACB354_03155) | - | 572244..572684 (+) | 441 | WP_002990052.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| ACB354_RS03160 (ACB354_03160) | - | 573148..573666 (+) | 519 | WP_011018130.1 | ParB N-terminal domain-containing protein | - |
| ACB354_RS03165 (ACB354_03165) | - | 573645..574322 (+) | 678 | WP_011018129.1 | ABC transporter ATP-binding protein | - |
| ACB354_RS03170 (ACB354_03170) | - | 574331..574714 (+) | 384 | WP_158296015.1 | GNAT family N-acetyltransferase | - |
| ACB354_RS03175 (ACB354_03175) | - | 574775..575152 (+) | 378 | WP_002986841.1 | ASCH domain-containing protein | - |
| ACB354_RS03180 (ACB354_03180) | - | 575194..575676 (+) | 483 | WP_281727461.1 | hypothetical protein | - |
| ACB354_RS03185 (ACB354_03185) | - | 575759..576970 (+) | 1212 | WP_011184805.1 | PBSX family phage terminase large subunit | - |
| ACB354_RS03190 (ACB354_03190) | - | 576984..578486 (+) | 1503 | WP_011184804.1 | phage portal protein | - |
| ACB354_RS03195 (ACB354_03195) | - | 578491..579984 (+) | 1494 | WP_011018124.1 | phage minor capsid protein | - |
| ACB354_RS03200 (ACB354_03200) | - | 579984..580211 (+) | 228 | WP_010922077.1 | hypothetical protein | - |
| ACB354_RS03205 (ACB354_03205) | - | 580298..580564 (+) | 267 | WP_010922078.1 | hypothetical protein | - |
| ACB354_RS03210 (ACB354_03210) | - | 580690..581304 (+) | 615 | WP_010922079.1 | hypothetical protein | - |
| ACB354_RS03215 (ACB354_03215) | - | 581308..582126 (+) | 819 | WP_010922080.1 | N4-gp56 family major capsid protein | - |
| ACB354_RS03220 (ACB354_03220) | - | 582180..582596 (+) | 417 | WP_011018123.1 | hypothetical protein | - |
| ACB354_RS03225 (ACB354_03225) | - | 582586..582918 (+) | 333 | WP_010922082.1 | minor capsid protein | - |
| ACB354_RS03230 (ACB354_03230) | - | 582918..583274 (+) | 357 | WP_010922083.1 | minor capsid protein | - |
| ACB354_RS03235 (ACB354_03235) | - | 583271..583669 (+) | 399 | WP_011018121.1 | minor capsid protein | - |
| ACB354_RS03240 (ACB354_03240) | - | 583669..584130 (+) | 462 | WP_011018120.1 | phage tail tube protein | - |
| ACB354_RS03245 (ACB354_03245) | - | 584174..584608 (+) | 435 | WP_011018119.1 | hypothetical protein | - |
| ACB354_RS03250 (ACB354_03250) | - | 584612..585193 (+) | 582 | WP_011018118.1 | Gp15 family bacteriophage protein | - |
| ACB354_RS03255 (ACB354_03255) | - | 585183..588443 (+) | 3261 | WP_021340629.1 | tape measure protein | - |
| ACB354_RS03260 (ACB354_03260) | - | 588440..589156 (+) | 717 | WP_011018116.1 | distal tail protein Dit | - |
| ACB354_RS03265 (ACB354_03265) | - | 589153..591300 (+) | 2148 | WP_023078210.1 | phage tail spike protein | - |
| ACB354_RS03270 (ACB354_03270) | - | 591300..592412 (+) | 1113 | WP_011184800.1 | hyaluronoglucosaminidase | - |
| ACB354_RS03275 (ACB354_03275) | - | 592427..594442 (+) | 2016 | WP_011184799.1 | gp58-like family protein | - |
| ACB354_RS03280 (ACB354_03280) | - | 594454..594882 (+) | 429 | WP_011184798.1 | DUF1617 family protein | - |
| ACB354_RS03285 (ACB354_03285) | - | 594885..595502 (+) | 618 | WP_011018111.1 | DUF1366 domain-containing protein | - |
| ACB354_RS03290 (ACB354_03290) | - | 595513..595812 (+) | 300 | WP_011184797.1 | hypothetical protein | - |
| ACB354_RS03295 (ACB354_03295) | - | 595809..595994 (+) | 186 | WP_011184796.1 | holin | - |
| ACB354_RS03300 (ACB354_03300) | - | 596107..597312 (+) | 1206 | WP_011184795.1 | glucosaminidase domain-containing protein | - |
| ACB354_RS03305 (ACB354_03305) | - | 597461..597625 (+) | 165 | WP_021340366.1 | hypothetical protein | - |
| ACB354_RS03310 (ACB354_03310) | - | 597658..598218 (+) | 561 | WP_011018106.1 | GNAT family N-acetyltransferase | - |
| ACB354_RS03315 (ACB354_03315) | sda | 598359..599357 (-) | 999 | WP_032463908.1 | streptodornase A | - |
| ACB354_RS03320 (ACB354_03320) | prx | 599597..599779 (+) | 183 | WP_011018104.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6935.81 Da Isoelectric Point: 3.9417
>NTDB_id=1037037 ACB354_RS03320 WP_011018104.1 599597..599779(+) (prx) [Streptococcus pyogenes strain Isolate 28]
MLTYDEFKQAIDNGYITADTVMIVRKNGQIFDYVLPHEEARNGEVVTEEVVEEVMVELDK
MLTYDEFKQAIDNGYITADTVMIVRKNGQIFDYVLPHEEARNGEVVTEEVVEEVMVELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=1037037 ACB354_RS03320 WP_011018104.1 599597..599779(+) (prx) [Streptococcus pyogenes strain Isolate 28]
ATGCTAACATACGACGAATTTAAGCAAGCGATTGACAATGGATATATCACAGCAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAAGAAGCGAGAAATGGAGAAGTTGTGACCGAGGAGGTAGTGGAAGAAG
TGATGGTGGAATTAGACAAATAA
ATGCTAACATACGACGAATTTAAGCAAGCGATTGACAATGGATATATCACAGCAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAAGAAGCGAGAAATGGAGAAGTTGTGACCGAGGAGGTAGTGGAAGAAG
TGATGGTGGAATTAGACAAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
83.333 |
100 |
0.833 |
| prx | Streptococcus pyogenes MGAS315 |
83.333 |
100 |
0.833 |
| prx | Streptococcus pyogenes MGAS315 |
81.667 |
100 |
0.817 |
| prx | Streptococcus pyogenes MGAS315 |
81.667 |
100 |
0.817 |
| prx | Streptococcus pyogenes MGAS8232 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
76.667 |
100 |
0.767 |
| prx | Streptococcus pyogenes MGAS315 |
93.023 |
71.667 |
0.667 |