Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | ACB341_RS05065 | Genome accession | NZ_CP167001 |
| Coordinates | 1008504..1008692 (-) | Length | 62 a.a. |
| NCBI ID | WP_011285559.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain Isolate 31 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1000920..1047230 | 1008504..1008692 | within | 0 |
Gene organization within MGE regions
Location: 1000920..1047230
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACB341_RS05030 (ACB341_05035) | pfkA | 1000920..1001933 (-) | 1014 | WP_010922375.1 | 6-phosphofructokinase | - |
| ACB341_RS05035 (ACB341_05040) | - | 1002013..1005123 (-) | 3111 | WP_010922376.1 | DNA polymerase III subunit alpha | - |
| ACB341_RS05040 (ACB341_05045) | - | 1005308..1005679 (+) | 372 | WP_010922377.1 | GntR family transcriptional regulator | - |
| ACB341_RS05045 (ACB341_05050) | - | 1005679..1006377 (+) | 699 | WP_002984437.1 | ABC transporter ATP-binding protein | - |
| ACB341_RS05050 (ACB341_05055) | - | 1006387..1007172 (+) | 786 | WP_010922378.1 | hypothetical protein | - |
| ACB341_RS05055 (ACB341_05060) | - | 1007299..1007913 (-) | 615 | WP_011285558.1 | TVP38/TMEM64 family protein | - |
| ACB341_RS05065 (ACB341_05070) | prx | 1008504..1008692 (-) | 189 | WP_011285559.1 | hypothetical protein | Regulator |
| ACB341_RS05070 (ACB341_05075) | speA | 1008912..1009667 (+) | 756 | WP_011285560.1 | streptococcal pyrogenic exotoxin SpeA | - |
| ACB341_RS05075 (ACB341_05080) | - | 1009789..1010448 (-) | 660 | WP_009880240.1 | hypothetical protein | - |
| ACB341_RS05080 (ACB341_05085) | - | 1010448..1010669 (-) | 222 | WP_009880241.1 | hypothetical protein | - |
| ACB341_RS05085 (ACB341_05090) | - | 1010679..1011452 (-) | 774 | WP_011054795.1 | hypothetical protein | - |
| ACB341_RS05090 (ACB341_05095) | - | 1011463..1012065 (-) | 603 | WP_011054796.1 | hypothetical protein | - |
| ACB341_RS05095 (ACB341_05100) | - | 1012077..1012841 (-) | 765 | WP_011285561.1 | CHAP domain-containing protein | - |
| ACB341_RS05100 (ACB341_05105) | - | 1012843..1013175 (-) | 333 | WP_011285562.1 | phage holin | - |
| ACB341_RS05105 (ACB341_05110) | - | 1013175..1013498 (-) | 324 | WP_015055952.1 | hypothetical protein | - |
| ACB341_RS05110 (ACB341_05115) | - | 1013512..1013634 (-) | 123 | WP_015055953.1 | hypothetical protein | - |
| ACB341_RS05115 (ACB341_05120) | - | 1013648..1013995 (-) | 348 | WP_011285564.1 | DUF1366 domain-containing protein | - |
| ACB341_RS05120 (ACB341_05125) | - | 1014006..1015868 (-) | 1863 | WP_015055954.1 | DUF859 family phage minor structural protein | - |
| ACB341_RS05125 (ACB341_05130) | - | 1015873..1019313 (-) | 3441 | WP_011285566.1 | glucosaminidase domain-containing protein | - |
| ACB341_RS05130 (ACB341_05135) | - | 1019314..1020798 (-) | 1485 | WP_009880250.1 | distal tail protein Dit | - |
| ACB341_RS05135 (ACB341_05140) | - | 1020799..1022604 (-) | 1806 | WP_011054802.1 | tail protein | - |
| ACB341_RS05140 (ACB341_05145) | - | 1022597..1023055 (-) | 459 | WP_009880253.1 | hypothetical protein | - |
| ACB341_RS05145 (ACB341_05150) | - | 1023028..1023345 (-) | 318 | WP_009880254.1 | hypothetical protein | - |
| ACB341_RS05150 (ACB341_05155) | - | 1023358..1023864 (-) | 507 | WP_009880255.1 | phage major tail protein, TP901-1 family | - |
| ACB341_RS05155 (ACB341_05160) | - | 1023876..1024286 (-) | 411 | WP_009880256.1 | DUF5072 family protein | - |
| ACB341_RS05160 (ACB341_05165) | - | 1024288..1024683 (-) | 396 | WP_009880257.1 | hypothetical protein | - |
| ACB341_RS05165 (ACB341_05170) | - | 1024680..1024991 (-) | 312 | WP_011285567.1 | hypothetical protein | - |
| ACB341_RS05170 (ACB341_05175) | - | 1024988..1025332 (-) | 345 | WP_009880259.1 | hypothetical protein | - |
| ACB341_RS05175 (ACB341_05180) | - | 1025346..1025639 (-) | 294 | WP_009880260.1 | HeH/LEM domain-containing protein | - |
| ACB341_RS05180 (ACB341_05185) | - | 1025652..1026542 (-) | 891 | WP_009880261.1 | hypothetical protein | - |
| ACB341_RS05185 (ACB341_05190) | - | 1026561..1027130 (-) | 570 | WP_009880262.1 | DUF4355 domain-containing protein | - |
| ACB341_RS05190 (ACB341_05195) | - | 1027239..1027373 (-) | 135 | WP_015055956.1 | hypothetical protein | - |
| ACB341_RS05195 (ACB341_05200) | - | 1027375..1027644 (-) | 270 | WP_011285568.1 | hypothetical protein | - |
| ACB341_RS05200 (ACB341_05205) | - | 1027651..1028559 (-) | 909 | WP_011285569.1 | minor capsid protein | - |
| ACB341_RS05205 (ACB341_05210) | - | 1028528..1029853 (-) | 1326 | WP_011285570.1 | phage portal protein | - |
| ACB341_RS05210 (ACB341_05215) | - | 1029853..1031127 (-) | 1275 | WP_009880266.1 | PBSX family phage terminase large subunit | - |
| ACB341_RS05215 (ACB341_05220) | - | 1031117..1031497 (-) | 381 | WP_011285571.1 | hypothetical protein | - |
| ACB341_RS05220 (ACB341_05225) | - | 1032107..1032541 (-) | 435 | WP_011054810.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| ACB341_RS05225 (ACB341_05230) | - | 1032827..1033093 (-) | 267 | WP_011018131.1 | hypothetical protein | - |
| ACB341_RS05230 (ACB341_05235) | - | 1033090..1033614 (-) | 525 | WP_011285572.1 | DUF1642 domain-containing protein | - |
| ACB341_RS05235 (ACB341_05240) | - | 1033617..1034249 (-) | 633 | WP_011018133.1 | N-6 DNA methylase | - |
| ACB341_RS05240 (ACB341_05245) | - | 1034251..1034535 (-) | 285 | WP_011018134.1 | hypothetical protein | - |
| ACB341_RS05245 (ACB341_05250) | - | 1034532..1034702 (-) | 171 | WP_002995952.1 | hypothetical protein | - |
| ACB341_RS05250 (ACB341_05255) | - | 1034699..1034935 (-) | 237 | WP_002995955.1 | DUF3310 domain-containing protein | - |
| ACB341_RS05255 (ACB341_05260) | - | 1034935..1035180 (-) | 246 | WP_011285573.1 | hypothetical protein | - |
| ACB341_RS05260 (ACB341_05265) | - | 1035177..1035533 (-) | 357 | WP_011284873.1 | hypothetical protein | - |
| ACB341_RS05265 (ACB341_05270) | - | 1035530..1035970 (-) | 441 | WP_011285574.1 | RusA family crossover junction endodeoxyribonuclease | - |
| ACB341_RS05270 (ACB341_05275) | - | 1035970..1036173 (-) | 204 | WP_011106686.1 | hypothetical protein | - |
| ACB341_RS05275 (ACB341_05280) | ssb | 1036179..1036604 (-) | 426 | WP_011285575.1 | single-stranded DNA-binding protein | Machinery gene |
| ACB341_RS05280 (ACB341_05285) | - | 1036597..1037271 (-) | 675 | WP_011285576.1 | ERF family protein | - |
| ACB341_RS05285 (ACB341_05290) | - | 1037272..1037754 (-) | 483 | WP_011285577.1 | siphovirus Gp157 family protein | - |
| ACB341_RS05290 (ACB341_05295) | - | 1037776..1038030 (-) | 255 | WP_011285578.1 | hypothetical protein | - |
| ACB341_RS05295 (ACB341_05300) | - | 1038011..1038364 (-) | 354 | WP_011285579.1 | hypothetical protein | - |
| ACB341_RS05300 (ACB341_05305) | - | 1038505..1039287 (-) | 783 | WP_011285581.1 | ATP-binding protein | - |
| ACB341_RS05305 (ACB341_05310) | - | 1039274..1040104 (-) | 831 | WP_009881060.1 | phage replisome organizer N-terminal domain-containing protein | - |
| ACB341_RS05310 (ACB341_05315) | - | 1040118..1040306 (-) | 189 | Protein_997 | XRE family transcriptional regulator | - |
| ACB341_RS05315 (ACB341_05320) | - | 1040540..1040779 (+) | 240 | WP_227874181.1 | hypothetical protein | - |
| ACB341_RS05320 (ACB341_05325) | - | 1040910..1041119 (+) | 210 | WP_011017885.1 | hypothetical protein | - |
| ACB341_RS05325 (ACB341_05330) | - | 1041229..1041429 (-) | 201 | WP_002992770.1 | helix-turn-helix domain-containing protein | - |
| ACB341_RS05330 (ACB341_05335) | - | 1041503..1041889 (+) | 387 | WP_011054589.1 | hypothetical protein | - |
| ACB341_RS05335 (ACB341_05340) | - | 1041878..1042087 (-) | 210 | WP_011284881.1 | hypothetical protein | - |
| ACB341_RS05340 (ACB341_05345) | - | 1042141..1042740 (+) | 600 | WP_011284882.1 | hypothetical protein | - |
| ACB341_RS05345 (ACB341_05350) | - | 1042770..1042928 (-) | 159 | WP_011285583.1 | hypothetical protein | - |
| ACB341_RS05350 (ACB341_05355) | - | 1043285..1044109 (+) | 825 | WP_011285584.1 | helix-turn-helix transcriptional regulator | - |
| ACB341_RS05355 (ACB341_05360) | - | 1044145..1045038 (+) | 894 | WP_011285585.1 | P63C domain-containing protein | - |
| ACB341_RS05360 (ACB341_05365) | - | 1045159..1046247 (+) | 1089 | WP_011054595.1 | site-specific integrase | - |
| ACB341_RS05365 (ACB341_05370) | - | 1046610..1047230 (+) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7290.41 Da Isoelectric Point: 4.3313
>NTDB_id=1036866 ACB341_RS05065 WP_011285559.1 1008504..1008692(-) (prx) [Streptococcus pyogenes strain Isolate 31]
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDYIK
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=1036866 ACB341_RS05065 WP_011285559.1 1008504..1008692(-) (prx) [Streptococcus pyogenes strain Isolate 31]
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
95.161 |
0.952 |
| prx | Streptococcus pyogenes MGAS315 |
79.032 |
100 |
0.79 |
| prx | Streptococcus pyogenes MGAS8232 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
95.161 |
0.71 |
| prx | Streptococcus pyogenes MGAS315 |
69.492 |
95.161 |
0.661 |
| prx | Streptococcus pyogenes MGAS315 |
82.927 |
66.129 |
0.548 |