Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   AB6A22_RS14785 Genome accession   NZ_CP166297
Coordinates   3053598..3053738 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain FCW119-1M2     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3048598..3058738
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB6A22_RS14760 (AB6A22_14765) - 3048938..3049321 (-) 384 WP_003152054.1 hotdog fold thioesterase -
  AB6A22_RS14765 (AB6A22_14770) comA 3049343..3049987 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  AB6A22_RS14770 (AB6A22_14775) comP 3050068..3052359 (-) 2292 WP_117614674.1 histidine kinase Regulator
  AB6A22_RS14775 (AB6A22_14780) comX 3052371..3052535 (-) 165 WP_007613432.1 competence pheromone ComX -
  AB6A22_RS14780 (AB6A22_14785) - 3052535..3053446 (-) 912 WP_014305720.1 polyprenyl synthetase family protein -
  AB6A22_RS14785 (AB6A22_14790) degQ 3053598..3053738 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  AB6A22_RS14790 (AB6A22_14795) - 3054204..3054545 (+) 342 WP_014305721.1 hypothetical protein -
  AB6A22_RS14795 (AB6A22_14800) - 3054552..3055772 (-) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  AB6A22_RS14800 (AB6A22_14805) - 3055902..3057368 (-) 1467 WP_088037313.1 nicotinate phosphoribosyltransferase -
  AB6A22_RS14805 (AB6A22_14810) - 3057386..3057937 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  AB6A22_RS14810 (AB6A22_14815) - 3058034..3058432 (-) 399 WP_003152031.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=1034080 AB6A22_RS14785 WP_003152043.1 3053598..3053738(-) (degQ) [Bacillus velezensis strain FCW119-1M2]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1034080 AB6A22_RS14785 WP_003152043.1 3053598..3053738(-) (degQ) [Bacillus velezensis strain FCW119-1M2]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891


Multiple sequence alignment