Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   BAMY6614_RS05510 Genome accession   NZ_CP006960
Coordinates   1114154..1114273 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   A7Z1C5
Organism   Bacillus amyloliquefaciens UMAF6614     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 1109154..1119273
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BAMY6614_RS05495 (BAMY6614_05765) - 1110766..1111449 (+) 684 WP_022552587.1 response regulator transcription factor -
  BAMY6614_RS05500 (BAMY6614_05770) - 1111436..1112863 (+) 1428 WP_089072406.1 sensor histidine kinase -
  BAMY6614_RS05505 (BAMY6614_05775) rapC 1113022..1114170 (+) 1149 WP_014304340.1 Rap family tetratricopeptide repeat protein Regulator
  BAMY6614_RS05510 (BAMY6614_05780) phrC 1114154..1114273 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  BAMY6614_RS05515 (BAMY6614_05790) - 1114425..1114535 (-) 111 WP_369878517.1 YjcZ family sporulation protein -
  BAMY6614_RS05520 (BAMY6614_05795) - 1114615..1115979 (-) 1365 WP_021495117.1 aspartate kinase -
  BAMY6614_RS05525 (BAMY6614_05800) ceuB 1116393..1117346 (+) 954 WP_015239156.1 ABC transporter permease Machinery gene
  BAMY6614_RS05530 (BAMY6614_05805) - 1117336..1118283 (+) 948 WP_014416905.1 iron chelate uptake ABC transporter family permease subunit -
  BAMY6614_RS05535 (BAMY6614_05810) - 1118277..1119035 (+) 759 WP_012116804.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=101906 BAMY6614_RS05510 WP_003156334.1 1114154..1114273(+) (phrC) [Bacillus amyloliquefaciens UMAF6614]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=101906 BAMY6614_RS05510 WP_003156334.1 1114154..1114273(+) (phrC) [Bacillus amyloliquefaciens UMAF6614]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A7Z1C5

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718


Multiple sequence alignment