Detailed information    

insolico Bioinformatically predicted

Overview


Name   nucA/comI   Type   Machinery gene
Locus tag   ABYM97_RS16575 Genome accession   NZ_CP159874
Coordinates   3207764..3208174 (-) Length   136 a.a.
NCBI ID   WP_009967785.1    Uniprot ID   A0A6I4D881
Organism   Bacillus subtilis strain PY79     
Function   cleavage of dsDNA into ssDNA (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 3203130..3254620 3207764..3208174 within 0


Gene organization within MGE regions


Location: 3203130..3254620
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABYM97_RS16550 (ABYM97_16550) yqeF 3203297..3204028 (-) 732 WP_003229964.1 SGNH/GDSL hydrolase family protein -
  ABYM97_RS16555 (ABYM97_16555) cwlH 3204280..3205032 (-) 753 WP_003229963.1 N-acetylmuramoyl-L-alanine amidase CwlH -
  ABYM97_RS16560 (ABYM97_16560) yqeD 3205219..3205845 (+) 627 WP_003229962.1 TVP38/TMEM64 family protein -
  ABYM97_RS16565 (ABYM97_16565) gnd 3205864..3206757 (-) 894 WP_003229961.1 phosphogluconate dehydrogenase (NAD(+)-dependent, decarboxylating) -
  ABYM97_RS16570 (ABYM97_16570) yqeB 3207009..3207731 (+) 723 WP_010886572.1 hypothetical protein -
  ABYM97_RS16575 (ABYM97_16575) nucA/comI 3207764..3208174 (-) 411 WP_009967785.1 sporulation-specific Dnase NucB Machinery gene
  ABYM97_RS16580 (ABYM97_16580) - 3208370..3208717 (+) 348 Protein_3245 sigma-70 family RNA polymerase sigma factor -
  ABYM97_RS16585 (ABYM97_16585) spoIVCA 3208748..3210208 (-) 1461 WP_223257626.1 site-specific DNA recombinase SpoIVCA -
  ABYM97_RS16590 (ABYM97_16590) - 3210166..3210344 (-) 179 Protein_3247 hypothetical protein -
  ABYM97_RS16595 (ABYM97_16595) arsC 3210699..3211118 (-) 420 WP_004398596.1 thioredoxin-dependent arsenate reductase -
  ABYM97_RS16600 (ABYM97_16600) acr3 3211130..3212170 (-) 1041 WP_004398718.1 arsenite efflux transporter Acr3 -
  ABYM97_RS16605 (ABYM97_16605) arsK 3212193..3212633 (-) 441 WP_003229954.1 ArsI/CadI family heavy metal resistance metalloenzyme -
  ABYM97_RS16610 (ABYM97_16610) arsR 3212694..3213011 (-) 318 WP_004399122.1 arsenical resistance operon transcriptional regulator ArsR -
  ABYM97_RS16615 (ABYM97_16615) yqcI 3213383..3214147 (-) 765 WP_004398670.1 YqcI/YcgG family protein -
  ABYM97_RS16620 (ABYM97_16620) rapE 3214590..3215717 (+) 1128 WP_004398842.1 response regulator aspartate phosphatase RapE -
  ABYM97_RS16625 (ABYM97_16625) phrE 3215707..3215841 (+) 135 WP_004398770.1 phosphatase RapE inhibitor PhrE -
  ABYM97_RS16630 (ABYM97_16630) - 3215951..3216109 (+) 159 WP_003245945.1 hypothetical protein -
  ABYM97_RS16635 (ABYM97_16635) yqcG 3216479..3218074 (+) 1596 WP_004399034.1 LXG family T7SS effector endonuclease toxin YqcG -
  ABYM97_RS16640 (ABYM97_16640) yqcF 3218089..3218667 (+) 579 WP_009967790.1 type VII secretion system immunity protein YqcF -
  ABYM97_RS16645 (ABYM97_16645) - 3218785..3218931 (+) 147 WP_009967791.1 hypothetical protein -
  ABYM97_RS16650 (ABYM97_16650) - 3218928..3219290 (-) 363 WP_003229947.1 hypothetical protein -
  ABYM97_RS16655 (ABYM97_16655) - 3219306..3219785 (-) 480 WP_004399085.1 hypothetical protein -
  ABYM97_RS16660 (ABYM97_16660) cwlA 3219950..3220768 (-) 819 WP_003229946.1 N-acetylmuramoyl-L-alanine amidase CwlA -
  ABYM97_RS16665 (ABYM97_16665) skhD 3220813..3221235 (-) 423 WP_003246208.1 holin family protein -
  ABYM97_RS16670 (ABYM97_16670) xepAK 3221280..3222173 (-) 894 WP_003246010.1 hypothetical protein -
  ABYM97_RS16675 (ABYM97_16675) yqcE 3222261..3222425 (-) 165 WP_003229944.1 XkdX family protein -
  ABYM97_RS16680 (ABYM97_16680) yqcD 3222422..3222757 (-) 336 WP_009967793.1 XkdW family protein -
  ABYM97_RS16685 (ABYM97_16685) yqcC 3222767..3223867 (-) 1101 WP_003229943.1 pyocin knob domain-containing protein -
  ABYM97_RS16690 (ABYM97_16690) - 3223870..3224142 (-) 273 WP_003229942.1 hypothetical protein -
  ABYM97_RS16695 (ABYM97_16695) yqcA 3224139..3224717 (-) 579 WP_003229941.1 YmfQ family protein -
  ABYM97_RS16700 (ABYM97_16700) yqbT 3224701..3225747 (-) 1047 WP_003229940.1 baseplate J/gp47 family protein -
  ABYM97_RS16705 (ABYM97_16705) yqbS 3225740..3226165 (-) 426 WP_004398572.1 DUF2634 domain-containing protein -
  ABYM97_RS16710 (ABYM97_16710) yqbR 3226178..3226441 (-) 264 WP_003229938.1 DUF2577 family protein -
  ABYM97_RS16715 (ABYM97_16715) yqbQ 3226438..3227418 (-) 981 WP_004398524.1 hypothetical protein -
  ABYM97_RS16720 (ABYM97_16720) yqbP 3227431..3228090 (-) 660 WP_004398548.1 LysM peptidoglycan-binding domain-containing protein -
  ABYM97_RS16725 (ABYM97_16725) yqbO 3228083..3232840 (-) 4758 WP_003246092.1 phage tail tape measure protein -
  ABYM97_RS16730 (ABYM97_16730) - 3232843..3232980 (-) 138 WP_003229934.1 hypothetical protein -
  ABYM97_RS16735 (ABYM97_16735) - 3233022..3233471 (-) 450 WP_003229933.1 phage portal protein -
  ABYM97_RS16740 (ABYM97_16740) txpA 3233617..3233796 (+) 180 WP_004398662.1 type I toxin-antitoxin system toxin TxpA -
  ABYM97_RS16745 (ABYM97_16745) bsrH 3234176..3234265 (+) 90 WP_075058862.1 type I toxin-antitoxin system toxin BsrH -
  ABYM97_RS16750 (ABYM97_16750) yqbM 3234519..3234962 (-) 444 WP_003229930.1 phage tail tube protein -
  ABYM97_RS16755 (ABYM97_16755) yqbK 3234965..3236365 (-) 1401 WP_003229929.1 phage tail sheath family protein -
  ABYM97_RS16760 (ABYM97_16760) - 3236366..3236557 (-) 192 WP_010886574.1 hypothetical protein -
  ABYM97_RS16765 (ABYM97_16765) yqbJ 3236554..3236991 (-) 438 WP_003229927.1 DUF6838 family protein -
  ABYM97_RS16770 (ABYM97_16770) yqbI 3237004..3237507 (-) 504 WP_003246050.1 HK97 gp10 family phage protein -
  ABYM97_RS16775 (ABYM97_16775) yqbH 3237504..3237866 (-) 363 WP_003229925.1 YqbH/XkdH family protein -
  ABYM97_RS16780 (ABYM97_16780) gkpG 3237863..3238258 (-) 396 WP_004398566.1 DUF3199 family protein -
  ABYM97_RS16785 (ABYM97_16785) yqbF 3238262..3238573 (-) 312 WP_003229923.1 YqbF domain-containing protein -
  ABYM97_RS16790 (ABYM97_16790) skdG 3238584..3239519 (-) 936 WP_003229922.1 phage major capsid protein -
  ABYM97_RS16795 (ABYM97_16795) yqbD 3239538..3240506 (-) 969 WP_003229921.1 XkdF-like putative serine protease domain-containing protein -
  ABYM97_RS16800 (ABYM97_16800) - 3240539..3241192 (-) 654 WP_003229920.1 hypothetical protein -
  ABYM97_RS16805 (ABYM97_16805) yqbB 3241233..3242150 (-) 918 WP_004398748.1 phage head morphogenesis protein -
  ABYM97_RS16810 (ABYM97_16810) yqbA 3242147..3243679 (-) 1533 WP_004398894.1 phage portal protein -
  ABYM97_RS16815 (ABYM97_16815) stmB 3243683..3244978 (-) 1296 WP_003229917.1 PBSX family phage terminase large subunit -
  ABYM97_RS16820 (ABYM97_16820) terS 3244971..3245690 (-) 720 WP_003229916.1 phage terminase small subunit -
  ABYM97_RS16825 (ABYM97_16825) - 3245758..3246222 (-) 465 WP_004398685.1 hypothetical protein -
  ABYM97_RS16830 (ABYM97_16830) yqaQ 3246366..3246821 (-) 456 WP_004398775.1 hypothetical protein -
  ABYM97_RS16835 (ABYM97_16835) - 3247019..3247948 (+) 930 WP_003229913.1 hypothetical protein -
  ABYM97_RS16840 (ABYM97_16840) yqaO 3248022..3248228 (-) 207 WP_003229912.1 XtrA/YqaO family protein -
  ABYM97_RS16845 (ABYM97_16845) yqaN 3248310..3248738 (-) 429 WP_009967809.1 RusA family crossover junction endodeoxyribonuclease -
  ABYM97_RS16850 (ABYM97_16850) - 3248834..3248983 (-) 150 WP_003229910.1 hypothetical protein -
  ABYM97_RS16855 (ABYM97_16855) sknM 3248974..3249915 (-) 942 WP_075058863.1 ATP-binding protein -
  ABYM97_RS16860 (ABYM97_16860) yqaL 3249797..3250474 (-) 678 WP_010886575.1 DnaD domain protein -
  ABYM97_RS16865 (ABYM97_16865) recT 3250550..3251404 (-) 855 WP_003229907.1 recombinase RecT -
  ABYM97_RS16870 (ABYM97_16870) yqaJ 3251407..3252366 (-) 960 WP_004398673.1 YqaJ viral recombinase family protein -
  ABYM97_RS16875 (ABYM97_16875) - 3252472..3252666 (-) 195 WP_003229905.1 hypothetical protein -
  ABYM97_RS16880 (ABYM97_16880) - 3252626..3252799 (-) 174 WP_119123069.1 hypothetical protein -
  ABYM97_RS16885 (ABYM97_16885) sknH 3252796..3253053 (-) 258 WP_003245994.1 YqaH family protein -
  ABYM97_RS16890 (ABYM97_16890) yqaG 3253050..3253619 (-) 570 WP_004398626.1 helix-turn-helix transcriptional regulator -
  ABYM97_RS16895 (ABYM97_16895) - 3253693..3253833 (-) 141 WP_003229902.1 hypothetical protein -
  ABYM97_RS16900 (ABYM97_16900) yqaF 3253863..3254093 (-) 231 WP_004398958.1 helix-turn-helix transcriptional regulator -
  ABYM97_RS16905 (ABYM97_16905) sknR 3254270..3254620 (+) 351 WP_004398704.1 transcriptional regulator SknR -

Sequence


Protein


Download         Length: 136 a.a.        Molecular weight: 14967.97 Da        Isoelectric Point: 5.1853

>NTDB_id=1016397 ABYM97_RS16575 WP_009967785.1 3207764..3208174(-) (nucA/comI) [Bacillus subtilis strain PY79]
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ

Nucleotide


Download         Length: 411 bp        

>NTDB_id=1016397 ABYM97_RS16575 WP_009967785.1 3207764..3208174(-) (nucA/comI) [Bacillus subtilis strain PY79]
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGGGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGTGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGTACCAGAGTGCTGTTTA
TTGTGCAGTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A6I4D881

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  nucA/comI Bacillus subtilis subsp. subtilis str. 168

62.609

84.559

0.529


Multiple sequence alignment