Detailed information    

insolico Bioinformatically predicted

Overview

Name   phrC   Type   Regulator
Locus tag   ABOE65_RS02015 Genome accession   NZ_CP158358
Coordinates   396940..397059 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain HY23     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context

Location: 391940..402059
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABOE65_RS02000 (ABOE65_01995) - 393552..394235 (+) 684 WP_007410267.1 response regulator transcription factor -
  ABOE65_RS02005 (ABOE65_02000) - 394222..395655 (+) 1434 WP_162303988.1 HAMP domain-containing sensor histidine kinase -
  ABOE65_RS02010 (ABOE65_02005) rapC 395808..396956 (+) 1149 WP_012116798.1 Rap family tetratricopeptide repeat protein Regulator
  ABOE65_RS02015 (ABOE65_02010) phrC 396940..397059 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  ABOE65_RS02020 (ABOE65_02015) - 397208..397303 (-) 96 WP_012116800.1 YjcZ family sporulation protein -
  ABOE65_RS02025 (ABOE65_02020) - 397398..398762 (-) 1365 WP_012116801.1 aspartate kinase -
  ABOE65_RS02030 (ABOE65_02025) ceuB 399176..400129 (+) 954 WP_012116802.1 ABC transporter permease Machinery gene
  ABOE65_RS02035 (ABOE65_02030) - 400119..401066 (+) 948 WP_012116803.1 iron chelate uptake ABC transporter family permease subunit -
  ABOE65_RS02040 (ABOE65_02035) - 401060..401818 (+) 759 WP_012116804.1 ABC transporter ATP-binding protein -

Sequence

Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=1010832 ABOE65_RS02015 WP_003156334.1 396940..397059(+) (phrC) [Bacillus velezensis strain HY23]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=1010832 ABOE65_RS02015 WP_003156334.1 396940..397059(+) (phrC) [Bacillus velezensis strain HY23]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA

Domains

Predicted by InterproScan.

Rap-phr extracellular signalling (PhrC_PhrF)

(3-39)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718

Multiple sequence alignment