Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   H0514_RS05170 Genome accession   NZ_LR822020
Coordinates   1013962..1014162 (-) Length   66 a.a.
NCBI ID   WP_006531882.1    Uniprot ID   A0ABP2DHE2
Organism   Streptococcus thermophilus isolate STH_CIRM_956     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context

Location: 1008962..1019162
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  H0514_RS05135 (STHERMO_1168) - 1009217..1009981 (-) 765 WP_232086163.1 DUF6261 family protein -
  H0514_RS05140 (STHERMO_1169) - 1010512..1011558 (-) 1047 WP_095559358.1 thioredoxin fold domain-containing protein -
  H0514_RS05145 (STHERMO_1170) - 1011739..1012143 (-) 405 WP_015695682.1 hypothetical protein -
  H0514_RS05150 - 1012201..1012293 (-) 93 Protein_964 Blp family class II bacteriocin -
  H0514_RS05155 (STHERMO_1171) - 1012507..1012818 (-) 312 WP_003066586.1 hypothetical protein -
  H0514_RS05160 (STHERMO_1172) - 1012907..1013137 (-) 231 WP_043878356.1 bacteriocin -
  H0514_RS05165 (STHERMO_1173) - 1013754..1013936 (-) 183 WP_006531883.1 Blp family class II bacteriocin -
  H0514_RS05170 (STHERMO_1174) cipB 1013962..1014162 (-) 201 WP_006531882.1 bacteriocin class II family protein Regulator
  H0514_RS05175 (STHERMO_1175) - 1014405..1014584 (-) 180 WP_095559357.1 hypothetical protein -
  H0514_RS05180 (STHERMO_1176) - 1014960..1015268 (-) 309 WP_018364976.1 bacteriocin immunity protein -
  H0514_RS05185 (STHERMO_1177) - 1015268..1015525 (-) 258 WP_095559356.1 garvicin Q family class II bacteriocin -
  H0514_RS05190 (STHERMO_1178) - 1015715..1015948 (-) 234 WP_095559355.1 Blp family class II bacteriocin -
  H0514_RS05195 (STHERMO_1179) - 1016106..1016408 (-) 303 WP_015695689.1 bacteriocin immunity protein -
  H0514_RS05200 - 1016420..1016623 (-) 204 Protein_974 garvicin Q family class II bacteriocin -
  H0514_RS05205 (STHERMO_1180) - 1016620..1017003 (-) 384 WP_095559354.1 hypothetical protein -
  H0514_RS05210 (STHERMO_1181) - 1017025..1017252 (-) 228 WP_058621356.1 bacteriocin class II family protein -
  H0514_RS05215 (STHERMO_1182) - 1017304..1017525 (-) 222 WP_101415610.1 Blp family class II bacteriocin -

Sequence

Protein


Download         Length: 66 a.a.        Molecular weight: 6536.51 Da        Isoelectric Point: 6.1394

>NTDB_id=1009974 H0514_RS05170 WP_006531882.1 1013962..1014162(-) (cipB) [Streptococcus thermophilus isolate STH_CIRM_956]
MNTKAFEQFDVMTDAELSTVEGGKSKEGRNMGCILGTAGMAGAGFLVAGPAGAAALGGATALRVCR

Nucleotide


Download         Length: 201 bp        

>NTDB_id=1009974 H0514_RS05170 WP_006531882.1 1013962..1014162(-) (cipB) [Streptococcus thermophilus isolate STH_CIRM_956]
ATGAATACAAAAGCATTTGAACAATTTGATGTAATGACAGATGCAGAACTTTCAACTGTTGAAGGTGGGAAAAGTAAAGA
AGGAAGAAATATGGGATGTATACTTGGCACTGCAGGTATGGCAGGAGCAGGCTTTTTAGTAGCAGGACCAGCAGGTGCTG
CCGCACTTGGCGGTGCTACCGCACTAAGAGTTTGTAGATAA

Domains

Predicted by InterProScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-58)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

52.174

69.697

0.364